Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Putative type II secretion system protein L (gspL)

This Recombinant Escherichia coli Putative type II secretion system protein L (gspL) spans the amino acid sequence from region 1-387.

Product Specifications

Product Name Alternative

Putative type II secretion system protein L, T2SS protein L, Putative general secretion pathway protein L

UniProt

P45763

Expression Region

1-387

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPESLMVIRSSSTLRKHWEWMTFSADSVSSVHTLTDDLPLESLADQPGAGNVHLLIPPEG LLYRSLTLPNAKYKLTAQTLQWLAEETLPDNTQDWHWTVVDKQNESVEVIGIQSEKLSRY LERLHTAGLNVTRVLPDGCYLPWEVDSWTLVNQQTSWLIRSAAHAFNELDEHWLQHLAAQ FPPENMLCYGVVPHGVAAANPLIQHPEIPSLSLYSADIAFQRYDMLHGIFRKQKTVSKSG KWLARLAVSCLVLAILSFVGSRSIALWHTLKIEDQLQQQQQETWQRYFPQIKRTHNFRFY FKQQLAQQYPEAVPLLYHLQTLLLEHPELQLMEANYSQKQKSLTLKMSAKSEANIDRFCE LTQSWLPMEKTEKDPVSGVWTVRNSGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR10D4 Antibody
8G498-AAT 50 µg

OR10D4 Antibody

Sign In for Pricing
View Details
Caspase-6 (CASP6) (NM_001226) Human Over-expression Lysate
LY400490 100 µg

Caspase-6 (CASP6) (NM_001226) Human Over-expression Lysate

Sign In for Pricing
View Details
4-tert-Octylphenol Monoethoxylate-13C6
TRC-O293842-1MG 1 mg

4-tert-Octylphenol Monoethoxylate-13C6

Sign In for Pricing
View Details
(R)-Phenylephrine Hydrochloride
TRC-P320640-5G 5 g

(R)-Phenylephrine Hydrochloride

Sign In for Pricing
View Details
Human p66 alpha (GATAD2A) activation kit by CRISPRa
GA110282 1 Kit

Human p66 alpha (GATAD2A) activation kit by CRISPRa

Sign In for Pricing
View Details
FATE1 Human qPCR Primer Pair (NM_033085)
HP216304 200 Reactions

FATE1 Human qPCR Primer Pair (NM_033085)

Sign In for Pricing
View Details