Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Putative type II secretion system protein L (gspL)

This Recombinant Escherichia coli Putative type II secretion system protein L (gspL) spans the amino acid sequence from region 1-387.

Product Specifications

Product Name Alternative

Putative type II secretion system protein L, T2SS protein L, Putative general secretion pathway protein L

UniProt

P45763

Expression Region

1-387

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPESLMVIRSSSTLRKHWEWMTFSADSVSSVHTLTDDLPLESLADQPGAGNVHLLIPPEG LLYRSLTLPNAKYKLTAQTLQWLAEETLPDNTQDWHWTVVDKQNESVEVIGIQSEKLSRY LERLHTAGLNVTRVLPDGCYLPWEVDSWTLVNQQTSWLIRSAAHAFNELDEHWLQHLAAQ FPPENMLCYGVVPHGVAAANPLIQHPEIPSLSLYSADIAFQRYDMLHGIFRKQKTVSKSG KWLARLAVSCLVLAILSFVGSRSIALWHTLKIEDQLQQQQQETWQRYFPQIKRTHNFRFY FKQQLAQQYPEAVPLLYHLQTLLLEHPELQLMEANYSQKQKSLTLKMSAKSEANIDRFCE LTQSWLPMEKTEKDPVSGVWTVRNSGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calnexin-NT Antibody: ATTO 488
SPC-127B-A488 200 µL

Calnexin-NT Antibody: ATTO 488

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS634054 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
THOC3 Rabbit Polyclonal Antibody
TA366511 100 µL

THOC3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EBLN2 Mouse Monoclonal Antibody [Clone ID: OTI1C5]
CF808872 100 µg

EBLN2 Mouse Monoclonal Antibody [Clone ID: OTI1C5]

Sign In for Pricing
View Details
Phthalanilic Acid (~90%)
TRC-P400758-5G 5 g

Phthalanilic Acid (~90%)

Sign In for Pricing
View Details
Sodium Lauryl Ether Sulfate
TRC-S960065-5G 5 g

Sodium Lauryl Ether Sulfate

Sign In for Pricing
View Details