Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Neisseria meningitidis serogroup B Capsule polysaccharide export inner-membrane protein CtrB (ctrB)

This Recombinant Neisseria meningitidis serogroup B Capsule polysaccharide export inner-membrane protein CtrB (ctrB) spans the amino acid sequence from region 1-387.

Product Specifications

Product Name Alternative

Capsule polysaccharide export inner-membrane protein CtrB

UniProt

P32014

Expression Region

1-387

Origin

Neisseria meningitidis serogroup B (strain MC58)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEQLPVAVATETKAERKKPKKKSWIKKLSPLFWVTVIIPTVISLVYFGFFASDRFTSQS SFVVRSPKSQSSLNGLGAILQGTGFARAQDDIYTVGEYMRSRSSLDELRKILPVREFYET KGDAFSRFNGFGFRGEEEAFYQYYKNQVMINFDTVSGISTLNVTSFDALESKKINEALLK QGEALINQLNDRARADTVRYAEEVVKTAAERVKEASQNLTDYRIANGVFDLKAQSEVQMG LVSKLQDELIVIQTQLDQVKAVTPENPQIPGLQAREQSLRKEIDQQLRAISGGGHSSLSN QAAEYQRVYLENQLAEQQLAAAMTSLESAKVEADRQQLYLEVISQPSLPDLAHEPKRLYN IVATLIIGLMVYGILSLLTASIREHKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea pig G-protein coupled receptor 4 (GPR4) ELISA Kit
MBS7206461-01 48 Well

Guinea pig G-protein coupled receptor 4 (GPR4) ELISA Kit

Sign In for Pricing
View Details
Guinea pig G-protein coupled receptor 4 (GPR4) ELISA Kit
MBS7206461-02 96 Well

Guinea pig G-protein coupled receptor 4 (GPR4) ELISA Kit

Sign In for Pricing
View Details
Guinea pig G-protein coupled receptor 4 (GPR4) ELISA Kit
MBS7206461-03 5x 96 Well

Guinea pig G-protein coupled receptor 4 (GPR4) ELISA Kit

Sign In for Pricing
View Details
Guinea pig G-protein coupled receptor 4 (GPR4) ELISA Kit
MBS7206461-04 10x 96 Well

Guinea pig G-protein coupled receptor 4 (GPR4) ELISA Kit

Sign In for Pricing
View Details
AZD5423
MBS5754563 Inquire

AZD5423

Sign In for Pricing
View Details
FGFBP2 siRNA Oligos set (Human)
20514171 3x 5 nmol

FGFBP2 siRNA Oligos set (Human)

Sign In for Pricing
View Details