Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Brucella abortus Type IV secretion system protein virB10 (virB10)

This Recombinant Brucella abortus Type IV secretion system protein virB10 (virB10) spans the amino acid sequence from region 1-388.

Product Specifications

Product Name Alternative

Type IV secretion system protein virB10

UniProt

Q2YJ81

Expression Region

1-388

Origin

Brucella abortus (strain 2308)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTQENIPVQPGTLDGERGLPTVNENGSGRTRKVLLFLFVVGFIVVLLLLLVFHMRGNAEN NHHSDKTMVQTSTVPMRTFKLPPPPPPAPPEPPAPPPAPAMPIAEPAAAALSLPPLPDDT PAKDDVLDKSASALMVVTKSSGDTNAQTAGDTVVQTTNARIQALLDSQKNTKQDAGSLGT LLHGTQTDARMASLLRNRDFLLAKGSIINCALQTRLDSTVPGMAACVVTRNMYSDNGKVL LIERGSTISGEYDANVKQGMARIYVLWTRVKTPNGVVIDLDSPGADPLGGAGLPGYIDSH FWKRFGGALMLSTIETLGRYATQKVGGGGSNQINLNTGGGESTSNLASTALKDTINIPPT LYKNQGEEIGIYIARDLDFSSVYDVKPK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pisum sativum Gel -PSA- Immobilized Lectin
A-2701-1 1 mL

Pisum sativum Gel -PSA- Immobilized Lectin

Sign In for Pricing
View Details
Alkaline Phosphatase (ALP) Activity Assay Kit
E-BC-K091-M-01 96 T (80 samples)

Alkaline Phosphatase (ALP) Activity Assay Kit

Sign In for Pricing
View Details
Alkaline Phosphatase (ALP) Activity Assay Kit
E-BC-K091-M-02 500 Assays (484 samples)

Alkaline Phosphatase (ALP) Activity Assay Kit

Sign In for Pricing
View Details
CD45RA (Leukocyte Marker) (K4B5), 0.2mg/mL
BNUB1680-500 1x 500 µL

CD45RA (Leukocyte Marker) (K4B5), 0.2mg/mL

Sign In for Pricing
View Details
TSGA10IP Antibody
KC-3595-01 50 μL

TSGA10IP Antibody

Sign In for Pricing
View Details
TSGA10IP Antibody
KC-3595-02 100 µL

TSGA10IP Antibody

Sign In for Pricing
View Details