Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Phosphate-binding protein pstS (pstS)

This Recombinant Methanocaldococcus jannaschii Phosphate-binding protein pstS (pstS) spans the amino acid sequence from region 1-389.

Product Specifications

Product Name Alternative

Phosphate-binding protein pstS, PBP

UniProt

Q58421

Expression Region

1-389

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNDTTQPTKGDAVKKILALILGLCLIVPVISIAGCVGGGNSQPSNNEKPSTIIIRTTGAT FPKYQIQKWIEDYQKTHPNVKIEYEGGGSGYGQEAFAKGLTDIGRTDPPVKESMWKKFLS TGDQPLQFPEIVGAVVVTYNIPEIGDKTLKLSRDVLADIFLGKIEYWDDERIKKINPEIA DKLPHEKIIVVHRSDASGTTAIFTTYLSLISKEWAEKVGAGKTVNWPTDNIGRGVAGKGN PGVVAIVKSTPYTVAYTELSYAIEQKLPVAALENKNGKFVKPTDETIKAAVSAVKASIPN PTEGYKEDLKQMLDAPGDNAYPIVAFTHLLVWENKNGKHYSPEKAKAIKDFLTWVLTEGQ KPEHLAPGYVGLPEDVAKIGLNAVNMIKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNFSF14 (Tumor Necrosis Factor Ligand Superfamily Member 14, CD258, Herpes Virus Entry Mediator Ligand, Herpes virus Entry Mediator Ligand, HVEML, HVEM-L, LIGHT, LTg, TR2, UNQ391/PRO726)
134556 100 µg

TNFSF14 (Tumor Necrosis Factor Ligand Superfamily Member 14, CD258, Herpes Virus Entry Mediator Ligand, Herpes virus Entry Mediator Ligand, HVEML, HVEM-L, LIGHT, LTg, TR2, UNQ391/PRO726)

Sign In for Pricing
View Details
Quick Step Human Cluster Of Differentiation 154 (CD154) elisa Kit
QS3393Hu-01 48 Tests

Quick Step Human Cluster Of Differentiation 154 (CD154) elisa Kit

Sign In for Pricing
View Details
Quick Step Human Cluster Of Differentiation 154 (CD154) elisa Kit
QS3393Hu-02 96 Tests

Quick Step Human Cluster Of Differentiation 154 (CD154) elisa Kit

Sign In for Pricing
View Details
2- (Benzylmethylamino) -4'-methylpropiophenone-d3
414018-01 1 mg

2- (Benzylmethylamino) -4'-methylpropiophenone-d3

Sign In for Pricing
View Details
2- (Benzylmethylamino) -4'-methylpropiophenone-d3
414018-02 2.5 mg

2- (Benzylmethylamino) -4'-methylpropiophenone-d3

Sign In for Pricing
View Details
TCPTP Protein, Mouse, Recombinant (aa 2-314, His Tag)
MBS8122987-01 0.1 mg

TCPTP Protein, Mouse, Recombinant (aa 2-314, His Tag)

Sign In for Pricing
View Details