Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Type II secretion system protein L (exeL)

This Recombinant Type II secretion system protein L (exeL) spans the amino acid sequence from region 1-389.

Product Specifications

Product Name Alternative

Type II secretion system protein L, T2SS protein L, General secretion pathway protein L

UniProt

P45789

Expression Region

1-389

Origin

Aeromonas hydrophila

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGEIFVSESLVIRLGTNAQQPVEWLVWSAKEEEIIASGILASAHALGELRERAGGRPVV TLVPGSDLIFRRVSLPGKYSRQAAAALPYLLEEQIASDVDELHLVVLGHEGHEVDLMAVD KEKMQIWLGWLQQAGLKSQQLLPDVLALPPAADGWSALQLGKEWLLRQGPCQGIVADESL LAMLLAAEADPVTIHSHTPLPAIPAANWLAADPELPMLLLAKGALNCQANLLQGPYRPQT EYSRYWLQWRKVAVVAGLLLLVALTQRGMHLYQLAEQDKALKAEIRQVYTRIFPGENRIV NVRSQMAQHLKLLGQTPQDGVLLLLTELAPTFAEVPGLKPQVLRFDAARGELRLQVTAPG FAEIERFRELAGKRFEVQQGEGAQHRGQG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IP6K1 Blocking Peptide
MBS9627878-01 1 mg

IP6K1 Blocking Peptide

Sign In for Pricing
View Details
IP6K1 Blocking Peptide
MBS9627878-02 5x 1 mg

IP6K1 Blocking Peptide

Sign In for Pricing
View Details
KLHDC1 Rabbit pAb, IRDye 800CW conjugated
orb2849184 100 µL

KLHDC1 Rabbit pAb, IRDye 800CW conjugated

Sign In for Pricing
View Details
Canine cutA divalent cation tolerance homolog (E. coli) (CUTA) ELISA Kit
MBS2613442-01 48 Well

Canine cutA divalent cation tolerance homolog (E. coli) (CUTA) ELISA Kit

Sign In for Pricing
View Details
Canine cutA divalent cation tolerance homolog (E. coli) (CUTA) ELISA Kit
MBS2613442-02 96 Well

Canine cutA divalent cation tolerance homolog (E. coli) (CUTA) ELISA Kit

Sign In for Pricing
View Details
Canine cutA divalent cation tolerance homolog (E. coli) (CUTA) ELISA Kit
MBS2613442-03 5x 96 Well

Canine cutA divalent cation tolerance homolog (E. coli) (CUTA) ELISA Kit

Sign In for Pricing
View Details