Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Type II secretion system protein L (exeL)

This Recombinant Type II secretion system protein L (exeL) spans the amino acid sequence from region 1-389.

Product Specifications

Product Name Alternative

Type II secretion system protein L, T2SS protein L, General secretion pathway protein L

UniProt

P45789

Expression Region

1-389

Origin

Aeromonas hydrophila

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGEIFVSESLVIRLGTNAQQPVEWLVWSAKEEEIIASGILASAHALGELRERAGGRPVV TLVPGSDLIFRRVSLPGKYSRQAAAALPYLLEEQIASDVDELHLVVLGHEGHEVDLMAVD KEKMQIWLGWLQQAGLKSQQLLPDVLALPPAADGWSALQLGKEWLLRQGPCQGIVADESL LAMLLAAEADPVTIHSHTPLPAIPAANWLAADPELPMLLLAKGALNCQANLLQGPYRPQT EYSRYWLQWRKVAVVAGLLLLVALTQRGMHLYQLAEQDKALKAEIRQVYTRIFPGENRIV NVRSQMAQHLKLLGQTPQDGVLLLLTELAPTFAEVPGLKPQVLRFDAARGELRLQVTAPG FAEIERFRELAGKRFEVQQGEGAQHRGQG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glycophorin A/CD235a (Erythrocyte Marker)
MBS4380967-01 0.02 mg (With BSA & Azide at 0.2mg/mL)

Glycophorin A/CD235a (Erythrocyte Marker)

Sign In for Pricing
View Details
Glycophorin A/CD235a (Erythrocyte Marker)
MBS4380967-02 0.1 mg (With BSA & Azide at 0.2mg/mL)

Glycophorin A/CD235a (Erythrocyte Marker)

Sign In for Pricing
View Details
Glycophorin A/CD235a (Erythrocyte Marker)
MBS4380967-03 0.1 mg (Without BSA & Azide at 1mg/mL)

Glycophorin A/CD235a (Erythrocyte Marker)

Sign In for Pricing
View Details
Glycophorin A/CD235a (Erythrocyte Marker)
MBS4380967-04 5x 0.1 mg (With BSA & Azide at 0.2mg/mL)

Glycophorin A/CD235a (Erythrocyte Marker)

Sign In for Pricing
View Details
Glycophorin A/CD235a (Erythrocyte Marker)
MBS4380967-05 5x 0.1 mg (Without BSA & Azide at 1mg/mL)

Glycophorin A/CD235a (Erythrocyte Marker)

Sign In for Pricing
View Details
Recombinant Paracoccus denitrificans Protein CrcB homolog (crcB)
orb2921936-01 20 µg

Recombinant Paracoccus denitrificans Protein CrcB homolog (crcB)

Sign In for Pricing
View Details