Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabbit ATP-sensitive inward rectifier potassium channel 11 (KCNJ11)

This Recombinant Rabbit ATP-sensitive inward rectifier potassium channel 11 (KCNJ11) spans the amino acid sequence from region 1-390.

Product Specifications

Product Name Alternative

ATP-sensitive inward rectifier potassium channel 11, Inward rectifier K (+) channel Kir6.2, Potassium channel, inwardly rectifying subfamily J member 11

UniProt

O02822

Expression Region

1-390

Origin

Oryctolagus cuniculus (Rabbit)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLSRKGIIPEEYVLTRLAEDPAEPRYRARERRARFVSKKGNCNVAHKNIREQGRFLQDVF TTLVDLKWTHTLLIFTMSFLCSWLLFAMVWWLIAFAHGDLAPGEGAAVPCVTSIHSFSSA FLFSIEVQVTIGFGGRMVTEECPLAILILIVQNIVGLMINAIMLGCIFMKTAQAHRRAET LIFSKHAVIALRQGRLCFMLRVGDLRKSMIISATIHMQVVRKTTSPEGEVVPLHQVDIPM ENGVGGNSIFLVAPLIIHHVIDANSPLYDLAPSDLHHHQDLEIIVILEGVVETTGITTQA RTSYLADEILWGQRFVPIVAEEDGRYSVDYSKFGNTVKVPTPLCTARQLDEDRSLLDALT LTSARGPLRKRSVPVAKAKPKFSISPDSLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 5AC (MUC5AC) (58M1), CF647 conjugate, 0.1mg/mL
BNC471003-500 1x 500 µL

Mucin 5AC (MUC5AC) (58M1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF647 conjugate, 0.1mg/mL
BNC470040-500 1x 500 µL

CD35 / CR1 (E11), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF488A conjugate, 0.1mg/mL
BNC880039-500 1x 500 µL

CD34 (ICO-115), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF488A conjugate, 0.1mg/mL
BNC880630-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF568 conjugate, 0.1mg/mL
BNC681050-100 1x 100 µL

CD3e (CRIS-7), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF740 conjugate, 0.1mg/mL
BNC740679-100 1x 100 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details