Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Cysteine-rich with EGF-like domain protein 1 (Creld1)

This Recombinant Mouse Cysteine-rich with EGF-like domain protein 1 (Creld1) spans the amino acid sequence from region 30-420.

Product Specifications

Product Name Alternative

Cysteine-rich with EGF-like domain protein 1

UniProt

Q91XD7

Expression Region

30-420

Origin

Mus musculus (Mouse)

Field of Research

Cancer Biology; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

QPSPPPHPSPRAEPHPCHTCRALVDNFNKGLERTIRDNFGGGNTAWEEEKLSKYKDSETR LVEVLEGVCSRSDFECHRLLELSEELVENWWFHRQQEAPDLFQWLCSDSLKLCCPSGTFG PSCLPCPGGTERPCGGYGQCEGEGTRGGSGHCDCQAGYGGEACGQCGLGYFEAERNSSHL VCSACFGPCARCTGPEESHCLQCKKGWALHHLKCVDIDECGTEQATCGADQFCVNTEGSY ECRDCAKACLGCMGAGPGRCKKCSRGYQQVGSKCLDVDECETVVCPGENEKCENTEGGYR CVCAEGYRQEDGICVKEQVPESAGFFAEMTEDEMVVLQQMFFGVIICALATLAAKGDLVF TAIFIGAVAAMTGYWLSERSDRVLEGFIKGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 Standard (DF1485), CF488A conjugate, 0.1mg/mL
BNC881037-100 1x 100 µL

CD44 Standard (DF1485), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF594 conjugate, 0.1mg/mL
BNC940039-100 1x 100 µL

CD34 (ICO-115), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF647 conjugate, 0.1mg/mL
BNC470352-100 1x 100 µL

CD31 / PECAM-1 (158-2B3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF594 conjugate, 0.1mg/mL
BNC941081-500 1x 500 µL

CD45RO (190-2F2.5), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ki-67 (Proliferating Cell Marker) (MKI67/2462), CF405S conjugate, 0.1mg/mL
BNC042462-500 1x 500 µL

Ki-67 (Proliferating Cell Marker) (MKI67/2462), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A / CHGA (Neuroendocrine Marker) (rCHGA/413), CF568 conjugate, 0.1mg/mL
BNC681906-100 1x 100 µL

Chromogranin A / CHGA (Neuroendocrine Marker) (rCHGA/413), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details