Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Turkey rhinotracheitis virus Major surface glycoprotein G (G)

This Recombinant Turkey rhinotracheitis virus Major surface glycoprotein G (G) spans the amino acid sequence from region 1-391.

Product Specifications

Product Name Alternative

Major surface glycoprotein G, Attachment glycoprotein G

UniProt

P33495

Expression Region

1-391

Origin

Turkey rhinotracheitis virus (TRTV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGSKLYMVQGTSAYQTAVGFWLDIGRRYILAIVLSAFGLTCTVTIALTVSVIVEQSVLEE CRNYNGGDRDWWSTTQEQPTTAPSATPAGNYGGLQTARTRKSESCLHVQISYGDMYSRSD TVLGGFDCMGLLVLCKSGPICQRDNQVDPTALCHCRVDLSSVDCCKVNKISTNSSTTSEP QKTNPAWPSQDNTDSDPNPQGITTSTATLLSTSLGLMLTSKTGTHKSGPPQALPGSNTNG KTTTDREPGPTNQPNSTTNGQHNKHTQRMTPPPSHDNTRTILQHTTPWEKTFSTYKPTHS PTNESDQSLPTTQNSINCEHFDPQGKEKICYRVGSYNSNITKQCRIDVPLCSTYSTVCMK TYYTEPFNCWRRIWRCLCDDGVGLVEWCCTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD100 (Semaphorin-4D) (A8), CF647 conjugate, 0.1mg/mL
BNC470218-500 1x 500 µL

CD100 (Semaphorin-4D) (A8), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF740 conjugate, 0.1mg/mL
BNC740009-100 1x 100 µL

MART-1 / Melan-A (M2-7C10), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF647 conjugate, 0.1mg/mL
BNC470630-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD68 (KP1), CF405S conjugate, 0.1mg/mL
BNC040512-100 1x 100 µL

CD68 (KP1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Calcineurin B / PPP3R1 (CALNB/2342), CF594 conjugate, 0.1mg/mL
BNC942342-500 1x 500 µL

Calcineurin B / PPP3R1 (CALNB/2342), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD68 (C68/684 + KP1), CF640R conjugate, 0.1mg/mL
BNC400685-100 1x 100 µL

CD68 (C68/684 + KP1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details