Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Equine herpesvirus 1 Envelope glycoprotein G (gG)

This Recombinant Equine herpesvirus 1 Envelope glycoprotein G (gG) spans the amino acid sequence from region 20-411.

Product Specifications

Product Name Alternative

Envelope glycoprotein G, gG

UniProt

P28967

Expression Region

20-411

Origin

Equine herpesvirus 1 (strain Ab4p) (EHV-1) (Equine abortion virus)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

RLAPDELCYAEPRRTGSPPNTQPERPPVIFEPPTIAIKAESKGCELILLDPPIDVSYRRE DKVNASIAWFFDFGACRMPIAYREYYGCIGNAVPSPETCDAYSFTLIRTEGIVEFTIVNM SLLFQPGIYDSGNFIYSVLLDYHIFTGRVTLEVEKDTNYPCGMIHGLTAYGNINVDETMD NASPHPRAVGCFPEPIDNEAWANVTFTELGIPDPNSFLDDEGDYPNISDCHSWESYTYPN TLRQATGPQTLLVGAVGLRILAQAWKFVGDETYDTIRAEAKNLETHVPSSAAESSLENQS TQEESNSPEVAHLRSVNSDDSTHTGGASNGIQDCDSQLKTVYACLALIGLGTCAMIGLIV YICVLRSKLSSRNFSRAQNVKHRNYQRLEYVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD5 (Cris-1), CF594 conjugate, 0.1mg/mL
BNC940176-500 1x 500 µL

CD5 (Cris-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF740 conjugate, 0.1mg/mL
BNC740633-100 1x 100 µL

Von Willebrand Factor (3E2D10), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD68 (KP1), CF488A conjugate, 0.1mg/mL
BNC880512-100 1x 100 µL

CD68 (KP1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TACSTD2 / TROP2 (Epithelial Marker) (TACSTD2/2153), CF405S conjugate, 0.1mg/mL
BNC042153-500 1x 500 µL

TACSTD2 / TROP2 (Epithelial Marker) (TACSTD2/2153), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Factor XIIIa (Coagulation Factor XIIIA Chain) (F13A1/1683), CF405S conjugate, 0.1mg/mL
BNC041683-500 1x 500 µL

Factor XIIIa (Coagulation Factor XIIIA Chain) (F13A1/1683), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (TFRC/1149), CF647 conjugate, 0.1mg/mL
BNC471149-100 1x 100 µL

CD71 (TFRC/1149), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details