Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine E3 ubiquitin-protein ligase RNF128 (RNF128)

This Recombinant Bovine E3 ubiquitin-protein ligase RNF128 (RNF128) spans the amino acid sequence from region 39-431.

Product Specifications

Product Name Alternative

E3 ubiquitin-protein ligase RNF128, EC= 6.3.2.-, RING finger protein 128

UniProt

Q29RU0

Expression Region

39-431

Origin

Bos taurus (Bovine)

Field of Research

Molecular Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AEAVWTAYLNVSWRVPHTGVNRTVWELSEEGVYGQDSPLEPVAGVLVPPDGPGALNACNP HTNFTVPTVPGDWGSSVQVSWLALIQRGGGCTFADKIHLAYERGASGAVIFNFPGTRNEV IPMSHPGAGDIVAIMIGNLKGTKILQSIQRGIQVTMVIEVGKKHGPWVNHYSIFFVSVSF FIITAATVGYFIFYSARRLRNARAQSRKQRQLKADAKKAIGRLQLRTQKQGDKEIGPDGD SCAVCIELYKPNDLVRILTCNHVFHKTCVDPWLLEHRTCPMCKCDILKALGIEVDVEDGS VSLQVPVSNETSSNASPHEEDNRSETASSGYASVQGADEPPLEEHAHSANENLQLVNHEA NSMAVDVVPHVDNPTFEEDESPDQETTVREIKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IgA Secretory Component (SC05), CF488A conjugate, 0.1mg/mL
BNC880050-500 1x 500 µL

IgA Secretory Component (SC05), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF405S conjugate, 0.1mg/mL
BNC040039-100 1x 100 µL

CD34 (ICO-115), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF647 conjugate, 0.1mg/mL
BNC470345-500 1x 500 µL

CD4 (EDU-2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF594 conjugate, 0.1mg/mL
BNC941050-500 1x 500 µL

CD3e (CRIS-7), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HER-2 / c-erbB-2 / neu / CD340 (ERBB2/2453), CF640R conjugate, 0.1mg/mL
BNC402453-500 1x 500 µL

HER-2 / c-erbB-2 / neu / CD340 (ERBB2/2453), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF740 conjugate, 0.1mg/mL
BNC741045-100 1x 100 µL

CD16 (C16/1045), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details