Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Short-chain dehydrogenase/reductase family 42E member 1 (SDR42E1)

This Recombinant Bovine Short-chain dehydrogenase/reductase family 42E member 1 (SDR42E1) spans the amino acid sequence from region 1-393.

Product Specifications

Product Name Alternative

Short-chain dehydrogenase/reductase family 42E member 1, EC= 1.1.1.-

UniProt

Q32L94

Expression Region

1-393

Origin

Bos taurus (Bovine)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDSHKSPKETVLITGGGGYFGFRLGCALNLLGVHVILFDISHPAQTIPEGIRFILGDIRC LSDIENAFQGVDVACVFHIASYGMSGREQLNRSLIEEINVGGTDNILQACRRRGVPRLVY TSTFNVIFGGQVIRNGDESLPYLPLHLHPDHYSRTKSIAEKKVLSANGTALERGGGVLST CALRPAGIYGPGEQRHLPRIVSYIEKGLFRFVYGDPKSLVEFVHVDNLVQAHILASEALK ANKGHIAAGQPYFISDGRPVNNFEFFRPLVEGLGYKFPSTRLPLTLIYCFAFLTEMTHFI LGRLYNFQPFLTRTEVYKTGVTHYFSLEKARKELGYEAQPFDLQEAVEWFKAHGHGRRPG SCDSKCLVWDGLVILLVVTVVLVWLLPSVILSM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD35 / CR1 (E11), CF405S conjugate, 0.1mg/mL
BNC040040-500 1x 500 µL

CD35 / CR1 (E11), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF405M conjugate, 0.1mg/mL
BNC051037-100 1x 100 µL

CD44 Standard (DF1485), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF640R conjugate, 0.1mg/mL
BNC400342-100 1x 100 µL

CD43 (84-3C1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF594 conjugate, 0.1mg/mL
BNC940026-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF488A conjugate, 0.1mg/mL
BNC880189-500 1x 500 µL

CD74 (BU45), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF555 conjugate, 0.1mg/mL
BNC550039-100 1x 100 µL

CD34 (ICO-115), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details