Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Short-chain dehydrogenase/reductase family 42E member 1 (SDR42E1)

This Recombinant Macaca fascicularis Short-chain dehydrogenase/reductase family 42E member 1 (SDR42E1) spans the amino acid sequence from region 1-393.

Product Specifications

Product Name Alternative

Short-chain dehydrogenase/reductase family 42E member 1, EC= 1.1.1.-

UniProt

Q4R7R1

Expression Region

1-393

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPKRSQKETVLITGGGGYFGFRLGCALNQKGVHVILFDISSPAETIPEGIKFIQGDICH LSDIEKAFQDADITCVFHIASYGMSGREQLNRNLIEEVNIGGTDNILQACQRRRVPRLVY TSTFNVIFGGQVIRNGDESLPYLPLHLHPDHYSRTKSIAEKKVLEANGTPLDRGDGVLRT CALRPAGIYGPGEQRHLPRIVSYIEKGLFKFVYGDPRSLVEFVHVDNLVQAHILASEALR ADKGHIASGQPYFISDGRPVNNFEFFRPLVEGLGYTFPSTRLPLTLVYCFAFLTEMVHFI LGRLYNFQPFLTRTEVYKTGVTHYFSLEKAKKELGYKAQPFDLQEAVEWFKAHGHGRSSG SRDSECFIWDGLLVFLLIIAVLIWLPSSVILSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WDR5B (N-term) Rabbit Polyclonal Antibody
AP54551PU-N 400 µL

WDR5B (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PCNA (Proliferating Cell Nuclear Antigen) (G1- & S-phase Marker) (PC5), CF405S conjugate, 0.1mg/mL
BNC043065-100 1x 100 µL

PCNA (Proliferating Cell Nuclear Antigen) (G1- & S-phase Marker) (PC5), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
WNT7B Human Gene Knockout Kit (CRISPR)
KN207691LP 1 Kit

WNT7B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FITC Anti-Human CD11b Antibody[HI11b]
E-AB-F1317C-01 20 Tests

FITC Anti-Human CD11b Antibody[HI11b]

Sign In for Pricing
View Details
FITC Anti-Human CD11b Antibody[HI11b]
E-AB-F1317C-02 100 Tests

FITC Anti-Human CD11b Antibody[HI11b]

Sign In for Pricing
View Details
FITC Anti-Human CD11b Antibody[HI11b]
E-AB-F1317C-03 2x 100 Tests

FITC Anti-Human CD11b Antibody[HI11b]

Sign In for Pricing
View Details