Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Short-chain dehydrogenase/reductase family 42E member 1 (Sdr42e1)

This Recombinant Mouse Short-chain dehydrogenase/reductase family 42E member 1 (Sdr42e1) spans the amino acid sequence from region 1-394.

Product Specifications

Product Name Alternative

Short-chain dehydrogenase/reductase family 42E member 1, EC= 1.1.1.-

UniProt

Q9D665

Expression Region

1-394

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDSPRFPEETVLITGGGGYFGFRLGCALNQKGARVILFDITQPAQNLPEGIKFVCGDIRC LADVETAFQDAEKVACVFHVASYGMSGREQLNKTQIEEVNVGGTENILRACLERGVPRLV YTSTFNVIFGGQVIRNGDESLPYLPLHLHPDHYSRTKSIAEKKVLEANGLAFKQGDGILR TCAIRPAGIYGAGEQRHLPRIVSYIERGLFRFVYGDPQSLVEFVHVDNLAKAHILASEAL KADKGHVASGQPYFISDGRPVNNFEFFRPLVEGLGYTFPSTRLPLTLIYCLAFLVEMTHF IVGRLYNFQPFLTRTEVYKTGVTHYFSLEKAKKELGFEPQPFDLQEVVEWFKAHGHGRGA AGQDSEFMLWDGILILLLALSVLTWILPSTTLSI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC2 (CCP58), CF405S conjugate, 0.1mg/mL
BNC040032-100 1x 100 µL

MUC2 (CCP58), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF740 conjugate, 0.1mg/mL
BNC740978-100 1x 100 µL

CD7 (T3-3A1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF405S conjugate, 0.1mg/mL
BNC041231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (Melanoma Marker) (TYR/2024R), CF405S conjugate, 0.1mg/mL
BNC042024-100 1x 100 µL

Tyrosinase (Melanoma Marker) (TYR/2024R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD56 / NCAM (NCAM1/795), CF594 conjugate, 0.1mg/mL
BNC940795-500 1x 500 µL

CD56 / NCAM (NCAM1/795), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (rKRT8.18/1346), CF647 conjugate, 0.1mg/mL
BNC472298-500 1x 500 µL

Cytokeratin 8/18 (rKRT8.18/1346), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details