Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ashbya gossypii Mitochondrial inner membrane i-AAA protease complex subunit MGR1 (MGR1)

This Recombinant Ashbya gossypii Mitochondrial inner membrane i-AAA protease complex subunit MGR1 (MGR1) spans the amino acid sequence from region 1-395.

Product Specifications

Product Name Alternative

Mitochondrial inner membrane i-AAA protease complex subunit MGR1

UniProt

Q751V6

Expression Region

1-395

Origin

Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MALFTPPSEDKDGRDRSGGGDKASGVVRTPFHLRPSLGLALWGPLVPASDNRAGLWTLVG LQTLMGAFFVSRFRALRPKLLKRDIADFPSLNRFSKTSGDMHVGPVHVFADFGGTHSFHR RAGESPGFFQSRRFVSLKRALYLSTGVVLLVQSALESARLTLLVYDPWEEQARGVRDKQF YNDVVRYYHEGVDPARFIVKDPASGNTLPVNVPEVKQGVALARAHTNARNIITRWLGPLD CKPLSSSEFLDKLEHYLDTCDFIQDMNNKRLFGNPAEVKARQKALDALIQANKENRRRIR HILDITPPRGLPLSPKAVDQGLRSIILDPDHESTEDLDLHELWSIYNPWVDLALDTSLSI KFLPTVRTPEELLGDSEDTAVEQKNPPVQIKRERG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat 5 Hydroxytryptamine Receptor 2B ELISA
GTR10441243 96 Well

Rat 5 Hydroxytryptamine Receptor 2B ELISA

Sign In for Pricing
View Details
TXNDC13 Double Nickase Plasmid (m2)
sc-424662-NIC-2 20 µg

TXNDC13 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
Sf3b3 3'UTR Lenti-reporter-Luc Vector
43570086 1.0 µg

Sf3b3 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
C5 Protein, Cynomolgus, Recombinant (His Tag)
MBS8123600-01 0.1 mg

C5 Protein, Cynomolgus, Recombinant (His Tag)

Sign In for Pricing
View Details
C5 Protein, Cynomolgus, Recombinant (His Tag)
MBS8123600-02 1 mg

C5 Protein, Cynomolgus, Recombinant (His Tag)

Sign In for Pricing
View Details
C5 Protein, Cynomolgus, Recombinant (His Tag)
MBS8123600-03 5x 1 mg

C5 Protein, Cynomolgus, Recombinant (His Tag)

Sign In for Pricing
View Details