Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sensor protein dltS (dltS)

This Recombinant Sensor protein dltS (dltS) spans the amino acid sequence from region 1-395.

Product Specifications

Product Name Alternative

Sensor protein dltS, EC= 2.7.13.3

UniProt

Q8E3C7

Expression Region

1-395

Origin

Streptococcus agalactiae serotype III

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFSDLRKKFVFLTMSILIVVVLFLFAVSNRYNQYWDEYDAYRIVKLVAKNDYLGIPGDEP IALVTIDNQKMVKIQSNNTDLTNDVIEKSSLKLLEQGKKSRKWKSFIYSIKEYKDKTYTI AIMDLASYEVPYARRFLILVFTIFGFCLLAAVSLYLSRFIVGPVETEMTREKQFVSDASH ELKTPIAAIRANVQVLEQQIPGNRYLDHVVSETKRMEFLIEDLLNLSRLDEKRSKVNFKK LNLSVLCQEVLLTYESLAYEEEKCLNDTIEDDVWIVGEESQIKQILIILLDNAIRHSLSK SEIQFSLKQARRKAILTISNPSAIYSKEVMDNLFERFYQAKDDHADSLSFGLGLSIAKAI VERHKGRIRAYQEKDQLRLEVQLPIDGFWTNTMIN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cdk5rap1 (NM_145721) Rat Tagged ORF Clone Lentiviral Particle
RR204390L3V 200 µL

Cdk5rap1 (NM_145721) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Phospho-TAOK1/2/3 (Ser181/Ser181/Ser177) Rabbit Monoclonal Antibody
AMRe84919-01 1 Each

Phospho-TAOK1/2/3 (Ser181/Ser181/Ser177) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Phospho-TAOK1/2/3 (Ser181/Ser181/Ser177) Rabbit Monoclonal Antibody
AMRe84919-02 50 µL

Phospho-TAOK1/2/3 (Ser181/Ser181/Ser177) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Phospho-TAOK1/2/3 (Ser181/Ser181/Ser177) Rabbit Monoclonal Antibody
AMRe84919-03 100 µL

Phospho-TAOK1/2/3 (Ser181/Ser181/Ser177) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Xanthomonas campestris pv. vesicatoria Indole-3-glycerol phosphate synthase (trpC)
MBS1449078-01 0.02 mg (E-Coli)

Recombinant Xanthomonas campestris pv. vesicatoria Indole-3-glycerol phosphate synthase (trpC)

Sign In for Pricing
View Details
Recombinant Xanthomonas campestris pv. vesicatoria Indole-3-glycerol phosphate synthase (trpC)
MBS1449078-02 0.02 mg (Yeast)

Recombinant Xanthomonas campestris pv. vesicatoria Indole-3-glycerol phosphate synthase (trpC)

Sign In for Pricing
View Details