Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bartonella henselae Type IV secretion system protein virB10 (virB10)

This Recombinant Bartonella henselae Type IV secretion system protein virB10 (virB10) spans the amino acid sequence from region 1-396.

Product Specifications

Product Name Alternative

Type IV secretion system protein virB10

UniProt

Q6G2B2

Expression Region

1-396

Origin

Bartonella henselae (strain ATCC 49882 / Houston 1) (Rochalimaea henselae)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNDPMDENNLLNDRDMIKDGHGKKQRPNTSKAAALVILFGVCLYLAYSTLFTEKQQPVEV QKEGIIKQTELFRPAPPKPVSLEPTIEKNNVLLPKVELPTPPKKTTNSDDSLLEAAQRAP VLAYANTQKGQGSTEKNKDISANQPEAKPDETAQRFNHLLKPTTLEGIRAAKLGNRNYII AMGASIPCILETAISSDQQGFASCIVSRDILSDNGRVVLLDKGTQIVGEYRAGLKKGQKR LFVLWNRAKTPNGIIITLASPATDALGRSGMDGDIDNHWLERIGSALLVSIVKDATNYVK GRLPKDQDKNNSETISSGQNIANIAVENYANIPPTLSKNQGEMVNVFVARDLDFSNVYKL KVIENKKQIVNRALSRNFYKNSAVICNEPKLAHIER

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Prostate
CS508776 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
Recombinant Human RSK3/RPS6KA2 Protein (GST Tag)
PKSH030377 50 µg

Recombinant Human RSK3/RPS6KA2 Protein (GST Tag)

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF740 conjugate, 0.1mg/mL
BNC740633-500 1x 500 µL

Von Willebrand Factor (3E2D10), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
METTL2A (NM_001005372) Human Over-expression Lysate
LY423705 100 µg

METTL2A (NM_001005372) Human Over-expression Lysate

Sign In for Pricing
View Details
(E)-p-Coumaroyl-CoA Sodium Salt
TRC-C304280-1MG 1 mg

(E)-p-Coumaroyl-CoA Sodium Salt

Sign In for Pricing
View Details
Calbindin 1 (CALB1) (CALB1/2364), CF640R conjugate, 0.1mg/mL
BNC402364-500 1x 500 µL

Calbindin 1 (CALB1) (CALB1/2364), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details