Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Yarrowia lipolytica Translocation protein SEC62 (SEC62)

This Recombinant Yarrowia lipolytica Translocation protein SEC62 (SEC62) spans the amino acid sequence from region 1-396.

Product Specifications

Product Name Alternative

Translocation protein SEC62

UniProt

Q99161

Expression Region

1-396

Origin

Yarrowia lipolytica (strain CLIB 122 / E 150) (Yeast) (Candida lipolytica)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTENVPQGQITMPLQQGGAREISPQALAVADYLRSHKLLKQRPGILNGKRSDFFRVKRAI RALEDPKYKQLQSKPNSKLPPINSRNEAISIFRLMPINQMALRVDKLPTQTALMMKQKPE QGVPVLQVNPQQEFGDDMYYTWFYNPVPLTTYLYGALGVAAIFAGVLFPLWPIFLRQGVW YLSVGMLGLIGVFFGIALVRLVIFVLTWPTVKPGIWIFPNLFADVGFVDSFIPLWAWHGT PERDLLPQKFKNKKKKKNAGTVIESKEPPRKLTKEEKQKQKEANAQMEQMQAAFQTQLSS FATQMQQIKEMSDSGIDPQIIAAQLQAQYPPDKQAAIKLENEQAQAKLDERIRELAAQIQ DKTNANKTGDKIEEVADKENKEAPKRIVTLEDANDE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD71 (66IG10), CF647 conjugate, 0.1mg/mL
BNC470871-500 1x 500 µL

CD71 (66IG10), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF640R conjugate, 0.1mg/mL
BNC400176-100 1x 100 µL

CD5 (Cris-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF740 conjugate, 0.1mg/mL
BNC740149-100 1x 100 µL

CD106 / VCAM1 (1.4C3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cyclin E (G1/S-Phase Cyclin) (CCNE1/2460), CF640R conjugate, 0.1mg/mL
BNC402460-500 1x 500 µL

Cyclin E (G1/S-Phase Cyclin) (CCNE1/2460), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Kappa Light Chain (Kap-56), CF594 conjugate, 0.1mg/mL
BNC940859-100 1x 100 µL

Human Kappa Light Chain (Kap-56), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GP2 (Glycoprotein 2) / ZAP75 (GP2/1805), CF594 conjugate, 0.1mg/mL
BNC941805-500 1x 500 µL

GP2 (Glycoprotein 2) / ZAP75 (GP2/1805), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details