Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Translocation protein SEC62 (SEC62)

This Recombinant Chicken Translocation protein SEC62 (SEC62) spans the amino acid sequence from region 1-398.

Product Specifications

Product Name Alternative

Translocation protein SEC62, Translocation protein 1, TP-1

UniProt

Q5F3A1

Expression Region

1-398

Origin

Gallus gallus (Chicken)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAERRRHRKRIQEVGEPFKEEKAVAKYLRFNCPTKSTNMMGHRVDYFIASKAVDCLLDSK WAKAKKGEEALFTTRESVVDYCNRLLKKQFFHRALKVMKMKPDKDTKKEKEKGKAESGKE EEKKSKKESSKDEKTKKEKEKKKDGEKEECKKDETPGTPKKKETKRKFKLEPHEDQVFLD GNEVYVWIYDPVHFKTFAMGLVLVIAVIAATLFPLWPAEMRVGVYYLSVGAGCFVASILL LAVARCILFLIIWLITGGRHHFWFLPNLTADVGFIDSFRPLYTHEYKGPKADLKKEEKSE SKKQQKYDSEEKSDSEKKEEEDGKTEATRNSGTEGSGGERHSDTDSDRREDDRSQHSSGN GNDFEMITKEELEQQTDEGDCEEDEDEDTESRPSHEKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

tp63 Antibody, FITC conjugated
A48565-50UG 50 µg

tp63 Antibody, FITC conjugated

Sign In for Pricing
View Details
Lentiviral human MYH14 sgRNA gene knockout kit - Lentiviral human MYH14 sgRNA gene knockout kit (100)
GTR15394516 1 Vial

Lentiviral human MYH14 sgRNA gene knockout kit - Lentiviral human MYH14 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Mmu-miR-669d-3p miRNA Mimic
CMM1000-01 5 nmol

Mmu-miR-669d-3p miRNA Mimic

Sign In for Pricing
View Details
Mmu-miR-669d-3p miRNA Mimic
CMM1000-02 10 nmol

Mmu-miR-669d-3p miRNA Mimic

Sign In for Pricing
View Details
B3GALT1 (Beta-1,3-galactosyltransferase 1, Beta-1,3-GalTase 1, Beta3Gal-T1, Beta3GalT1, 241-, UDP-galactose:beta-N-acetyl-glucosamine-beta-1,3-galactosyltransferase 1, B3GALT1) (MaxLight 550) discontinued
302282-ML550 100 µL

B3GALT1 (Beta-1,3-galactosyltransferase 1, Beta-1,3-GalTase 1, Beta3Gal-T1, Beta3GalT1, 241-, UDP-galactose:beta-N-acetyl-glucosamine-beta-1,3-galactosyltransferase 1, B3GALT1) (MaxLight 550) discontinued

Sign In for Pricing
View Details
STAT1, NT (Signal Transducer And Activator Of Transcription 1-alpha/beta, Transcription Factor ISGF-3 Components p91/p84, STAT1alpha, STAT1b, Signal Transducer And Activator Of Transcription 1 91kD)
350839 100 µg

STAT1, NT (Signal Transducer And Activator Of Transcription 1-alpha/beta, Transcription Factor ISGF-3 Components p91/p84, STAT1alpha, STAT1b, Signal Transducer And Activator Of Transcription 1 91kD)

Sign In for Pricing
View Details