Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Translocation protein SEC62 (SEC62)

This Recombinant Chicken Translocation protein SEC62 (SEC62) spans the amino acid sequence from region 1-398.

Product Specifications

Product Name Alternative

Translocation protein SEC62, Translocation protein 1, TP-1

UniProt

Q5F3A1

Expression Region

1-398

Origin

Gallus gallus (Chicken)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAERRRHRKRIQEVGEPFKEEKAVAKYLRFNCPTKSTNMMGHRVDYFIASKAVDCLLDSK WAKAKKGEEALFTTRESVVDYCNRLLKKQFFHRALKVMKMKPDKDTKKEKEKGKAESGKE EEKKSKKESSKDEKTKKEKEKKKDGEKEECKKDETPGTPKKKETKRKFKLEPHEDQVFLD GNEVYVWIYDPVHFKTFAMGLVLVIAVIAATLFPLWPAEMRVGVYYLSVGAGCFVASILL LAVARCILFLIIWLITGGRHHFWFLPNLTADVGFIDSFRPLYTHEYKGPKADLKKEEKSE SKKQQKYDSEEKSDSEKKEEEDGKTEATRNSGTEGSGGERHSDTDSDRREDDRSQHSSGN GNDFEMITKEELEQQTDEGDCEEDEDEDTESRPSHEKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CBE1 CRISPR Activation Plasmid (m2)
sc-428630-ACT-2 20 µg

CBE1 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
B7H4 antibody (PE)
MBS834107-01 100 Pieces

B7H4 antibody (PE)

Sign In for Pricing
View Details
B7H4 antibody (PE)
MBS834107-02 5x 100 Pieces

B7H4 antibody (PE)

Sign In for Pricing
View Details
Rabbit Polyclonal ZNRF2 Antibody [Alexa Fluor 647]
NBP1-28697AF647 0.1 mL

Rabbit Polyclonal ZNRF2 Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details
CUL3 (Cullin-3, CUL-3, PHA2E) (PE)
MBS6413130-01 0.1 mL

CUL3 (Cullin-3, CUL-3, PHA2E) (PE)

Sign In for Pricing
View Details
CUL3 (Cullin-3, CUL-3, PHA2E) (PE)
MBS6413130-02 5x 0.1 mL

CUL3 (Cullin-3, CUL-3, PHA2E) (PE)

Sign In for Pricing
View Details