Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein F54F2.9 (F54F2.9)

This Recombinant Uncharacterized protein F54F2.9 (F54F2.9) spans the amino acid sequence from region 17-414.

Product Specifications

Product Name Alternative

Uncharacterized protein F54F2.9

UniProt

P34454

Expression Region

17-414

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

QWTSEDLALYDLVEEVGVNFYEWFDIPRDASSNQVKKAYRKLTLEWHPDRNSAPDATEKF RQVAGIYEVLKTTELREKYDNVLENGLPSWRHPMYYYRRMRKLAWYEGILVLLFIGTIAH YLMMWAAYFEKTLVYKQNVKKSRKSKKEDPAEAEKLMKQALEEYLPKYSELLPIILARGT VTLFKNLALTAKDAMTPKEVEPEEPTEEELAQQRRQQRAAAAPQQLEFKFEVAQGMKAVS TNDPEMEKKYAAENEVVAQKQSGATWTPDELASLVRLSTEKYPAGTPNRWEQMGRVLNRS AEDVIAMAGKMKQMKQEDYTKLLMTTIQQSVPVEEKSEDDWSQAEQKAFETALQKYPKGT DERWERISEEIGSKTKKQVMVRFKQLAEMIRKKKTNDT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polystyrene C4 PHB
HB04508013.5G 5 g

Polystyrene C4 PHB

Sign In for Pricing
View Details
CALHM6 (NM_001010919) Human Over-expression Lysate
LY423229 100 µg

CALHM6 (NM_001010919) Human Over-expression Lysate

Sign In for Pricing
View Details
cIAP1 (BIRC2) Rabbit Polyclonal Antibody
TA392505 100 µL

cIAP1 (BIRC2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MAPT / TAU pThr212 Rabbit Polyclonal Antibody
AP08019PU-S 50 µL

MAPT / TAU pThr212 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS639375 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
iFluor™ 488 Conjugated Actin Recombinant Rabbit Monoclonal Antibody [JJ09-29]
HA720160F 100 µL

iFluor™ 488 Conjugated Actin Recombinant Rabbit Monoclonal Antibody [JJ09-29]

Sign In for Pricing
View Details