Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein F54F2.9 (F54F2.9)

This Recombinant Uncharacterized protein F54F2.9 (F54F2.9) spans the amino acid sequence from region 17-414.

Product Specifications

Product Name Alternative

Uncharacterized protein F54F2.9

UniProt

P34454

Expression Region

17-414

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

QWTSEDLALYDLVEEVGVNFYEWFDIPRDASSNQVKKAYRKLTLEWHPDRNSAPDATEKF RQVAGIYEVLKTTELREKYDNVLENGLPSWRHPMYYYRRMRKLAWYEGILVLLFIGTIAH YLMMWAAYFEKTLVYKQNVKKSRKSKKEDPAEAEKLMKQALEEYLPKYSELLPIILARGT VTLFKNLALTAKDAMTPKEVEPEEPTEEELAQQRRQQRAAAAPQQLEFKFEVAQGMKAVS TNDPEMEKKYAAENEVVAQKQSGATWTPDELASLVRLSTEKYPAGTPNRWEQMGRVLNRS AEDVIAMAGKMKQMKQEDYTKLLMTTIQQSVPVEEKSEDDWSQAEQKAFETALQKYPKGT DERWERISEEIGSKTKKQVMVRFKQLAEMIRKKKTNDT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATTO 488 acid
2813-AAT 10 mg

ATTO 488 acid

Sign In for Pricing
View Details
SEMA5A (C-term) Rabbit Polyclonal Antibody
AP12325PU-N 400 µL

SEMA5A (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Usp46 Mouse Gene Knockout Kit (CRISPR)
KN518804 1 Kit

Usp46 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PD-123319 Bis(Trifluoroacetic Acid Salt) Hydrate
TRC-P217475-100MG 100 mg

PD-123319 Bis(Trifluoroacetic Acid Salt) Hydrate

Sign In for Pricing
View Details
VEGF Receptor 1 (FLT1) Mouse Monoclonal Antibody [Clone ID: OTI8G6]
CF806766 100 µg

VEGF Receptor 1 (FLT1) Mouse Monoclonal Antibody [Clone ID: OTI8G6]

Sign In for Pricing
View Details
PSD3 (NM_015310) Human Recombinant Protein
TP320303L 1 mg

PSD3 (NM_015310) Human Recombinant Protein

Sign In for Pricing
View Details