Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Type II secretion system protein L (outL)

This Recombinant Type II secretion system protein L (outL) spans the amino acid sequence from region 1-399.

Product Specifications

Product Name Alternative

Type II secretion system protein L, T2SS protein L, General secretion pathway protein L, Pectic enzymes secretion protein OutL

UniProt

P31707

Expression Region

1-399

Origin

Erwinia chrysanthemi

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKAENTSGKQQLILRLSADTSDSLEWLIWSVSRHQTLTTGSGTLESLQAVLADYPVISA RVLVPSTDVTFHTLSLPRQSRRQLLQAIPFMLEEQVASDIDQLHFAVMDMHGDNATVAVV QKSRLRAWLNQCETLGVPVETVVPDVMALPRADSAWSAISHRNLWLFRLDSGIGMAAEEN WYQSLLAFQPLPAVHCYSPVPASALTWQPQPVTDLLTLAAQVNLSMSMDLRQGEYAPVKP WKQALLPWRNVLIALSAWLLLVLGESVWTHYQWYRQADYWRQESVRVYRKLFPDEKQVVN PRAQMQRHLQEVRAGVSGFALTEQMNRLQQLVAQNEGVSLQSLSYDRSRDELRLSLRATS YAQMEQFRQQAQAYFQIPPGEMKQEKDHVEGQLTLRSQP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MaeA Antibody
orb818054 2 mg

MaeA Antibody

Sign In for Pricing
View Details
FGD2 Human qPCR Primer Pair (NM_173558)
HP218372 200 Reactions

FGD2 Human qPCR Primer Pair (NM_173558)

Sign In for Pricing
View Details
Olr1252 sgRNA CRISPR Lentivector (Rat) (Target 1)
K7242502 1.0 µg DNA

Olr1252 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
PFK 15
462334-01 5 mg

PFK 15

Sign In for Pricing
View Details
PFK 15
462334-02 10 mg

PFK 15

Sign In for Pricing
View Details
Pax1 Rat siRNA Oligo Duplex (Locus ID 311505)
SR506157 1 Kit

Pax1 Rat siRNA Oligo Duplex (Locus ID 311505)

Sign In for Pricing
View Details