Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Type II secretion system protein L (outL)

This Recombinant Type II secretion system protein L (outL) spans the amino acid sequence from region 1-399.

Product Specifications

Product Name Alternative

Type II secretion system protein L, T2SS protein L, General secretion pathway protein L, Pectic enzymes secretion protein OutL

UniProt

P31707

Expression Region

1-399

Origin

Erwinia chrysanthemi

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKAENTSGKQQLILRLSADTSDSLEWLIWSVSRHQTLTTGSGTLESLQAVLADYPVISA RVLVPSTDVTFHTLSLPRQSRRQLLQAIPFMLEEQVASDIDQLHFAVMDMHGDNATVAVV QKSRLRAWLNQCETLGVPVETVVPDVMALPRADSAWSAISHRNLWLFRLDSGIGMAAEEN WYQSLLAFQPLPAVHCYSPVPASALTWQPQPVTDLLTLAAQVNLSMSMDLRQGEYAPVKP WKQALLPWRNVLIALSAWLLLVLGESVWTHYQWYRQADYWRQESVRVYRKLFPDEKQVVN PRAQMQRHLQEVRAGVSGFALTEQMNRLQQLVAQNEGVSLQSLSYDRSRDELRLSLRATS YAQMEQFRQQAQAYFQIPPGEMKQEKDHVEGQLTLRSQP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ID4 (DNA-binding Protein Inhibitor ID-4, Class B Basic Helix-loop-helix Protein 27, bHLHb27, Inhibitor of DNA Binding 4, BHLHB27) (MaxLight 405) discontinued
029511-ML405 100 µL

ID4 (DNA-binding Protein Inhibitor ID-4, Class B Basic Helix-loop-helix Protein 27, bHLHb27, Inhibitor of DNA Binding 4, BHLHB27) (MaxLight 405) discontinued

Sign In for Pricing
View Details
HOXB9 Rabbit pAb
E2510222 100 µL

HOXB9 Rabbit pAb

Sign In for Pricing
View Details
MRPL41 Antibody
orb1553663-01 50 μL

MRPL41 Antibody

Sign In for Pricing
View Details
MRPL41 Antibody
orb1553663-02 100 µL

MRPL41 Antibody

Sign In for Pricing
View Details
MRPL41 Antibody
orb1553663-03 200 µL

MRPL41 Antibody

Sign In for Pricing
View Details
Dopamine D1 Receptor (D1R) Mouse ELISA Kit
C9929 96 Tests

Dopamine D1 Receptor (D1R) Mouse ELISA Kit

Sign In for Pricing
View Details