Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Type II secretion system protein L (outL)

This Recombinant Type II secretion system protein L (outL) spans the amino acid sequence from region 1-399.

Product Specifications

Product Name Alternative

Type II secretion system protein L, T2SS protein L, General secretion pathway protein L, Pectic enzymes secretion protein OutL

UniProt

P31707

Expression Region

1-399

Origin

Erwinia chrysanthemi

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKAENTSGKQQLILRLSADTSDSLEWLIWSVSRHQTLTTGSGTLESLQAVLADYPVISA RVLVPSTDVTFHTLSLPRQSRRQLLQAIPFMLEEQVASDIDQLHFAVMDMHGDNATVAVV QKSRLRAWLNQCETLGVPVETVVPDVMALPRADSAWSAISHRNLWLFRLDSGIGMAAEEN WYQSLLAFQPLPAVHCYSPVPASALTWQPQPVTDLLTLAAQVNLSMSMDLRQGEYAPVKP WKQALLPWRNVLIALSAWLLLVLGESVWTHYQWYRQADYWRQESVRVYRKLFPDEKQVVN PRAQMQRHLQEVRAGVSGFALTEQMNRLQQLVAQNEGVSLQSLSYDRSRDELRLSLRATS YAQMEQFRQQAQAYFQIPPGEMKQEKDHVEGQLTLRSQP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit CD40 Ligand / TNFSF5 Protein, His, Flag Tag (active trimer) (MALS verified)
CD0-R52D9-100ug 100 µg

Rabbit CD40 Ligand / TNFSF5 Protein, His, Flag Tag (active trimer) (MALS verified)

Sign In for Pricing
View Details
Wall Mounting Kit (TANK30)
WAT2448 1 Each

Wall Mounting Kit (TANK30)

Sign In for Pricing
View Details
TRPM7, NT (Transient Receptor Potential Cation Channel Subfamily M Member 7, Long Transient Receptor Potential Channel 7, LTrpC-7, Channel-kinase 1, CHAK1, LTRPC7) (FITC) discontinued
T8666-37U-FITC 200 µL

TRPM7, NT (Transient Receptor Potential Cation Channel Subfamily M Member 7, Long Transient Receptor Potential Channel 7, LTrpC-7, Channel-kinase 1, CHAK1, LTRPC7) (FITC) discontinued

Sign In for Pricing
View Details
C1QL1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0219905 3x 1.0 µg

C1QL1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
MIR93 Human MicroRNA Expression Plasmid (MI0000095)
SC400685 10 µg

MIR93 Human MicroRNA Expression Plasmid (MI0000095)

Sign In for Pricing
View Details
Rabbit Abelson helper integration site 1 protein homolog ELISA kit
GTR10442054 96 Well

Rabbit Abelson helper integration site 1 protein homolog ELISA kit

Sign In for Pricing
View Details