Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Candida albicans Mitochondrial import inner membrane translocase subunit TIM54 (TIM54)

This Recombinant Candida albicans Mitochondrial import inner membrane translocase subunit TIM54 (TIM54) spans the amino acid sequence from region 1-400.

Product Specifications

Product Name Alternative

Mitochondrial import inner membrane translocase subunit TIM54

UniProt

P48990

Expression Region

1-400

Origin

Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPDANEVKPKKGWSNPALRMMGIPRISLPSRNWMIFWTVVTTIGGGIAYDKYEQKQMRKK WMDAVKQFGEVSYGANEIPRKLSIFIAPPPNDFLDESLKLFRKFIKPVLNAGVVDFEIFS ESRQGDIRASVAEKIRELRRKQLVEETPKKNESNGNQDNDEEELKSRSDLYKAKDVLGLY KVFPADINVKSEDAIDDSSAGGIICVGRGAYKEYLSGVHEGLLGPLEKPQSVIDEETKLA EEKKKEKEENPDKDDDNDEEQSNLKPVPLRYIQPEDYANAQLAPELDLSTVVKDDKGVPV FFEQPVYTFPLPNLVGFTNIPRKIYRYFTKRFLVDDFGERTATIVNNKSRPFVYKDVLMA KEEEMDWPKKWVEKGKERNSEWVQELEHDERVTSRMKVFE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (CRIS-7), CF405S conjugate, 0.1mg/mL
BNC041050-500 1x 500 µL

CD3e (CRIS-7), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF640R conjugate, 0.1mg/mL
BNC400204-500 1x 500 µL

Complement C4d (C4D204), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF555 conjugate, 0.1mg/mL
BNC550039-500 1x 500 µL

CD34 (ICO-115), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HCG-beta (HCGb/54+ HCGb/459), CF647 conjugate, 0.1mg/mL
BNC471224-100 1x 100 µL

HCG-beta (HCGb/54+ HCGb/459), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (QBEnd/10), CF740 conjugate, 0.1mg/mL
BNC740640-500 1x 500 µL

CD34 (QBEnd/10), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e, Mouse (145-2C11), CF405S conjugate, 0.1mg/mL
BNC042013-100 1x 100 µL

CD3e, Mouse (145-2C11), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details