Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Reticulon-4 receptor-like 1 (Rtn4rl1)

This Recombinant Rat Reticulon-4 receptor-like 1 (Rtn4rl1) spans the amino acid sequence from region 25-424.

Product Specifications

Product Name Alternative

Reticulon-4 receptor-like 1, Nogo receptor-like 2, Nogo-66 receptor homolog 2, Nogo-66 receptor-related protein 3, NgR3

UniProt

Q80WD0

Expression Region

25-424

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CPRDCVCYPSPMTVSCQAHNFAAIPEGIPEDSERIFLQNNHITFLQQGHFSPAMVTLWIY SNNITFIAPNTFEGFVHLEELDLGDNRQLRTLAPETFQGLVKLHALYLYKCGLSSLPAGI FGGLHSLQYLYLQDNHIEYLQDDIFVDLVNLSHLFLHGNKLWSLGQGIFRGLVNLDRLLL HENQLQWVHHKAFHDLHRLTTLFLFNNSLTELQGDCLAPLVALEFLRLNGNAWDCGCRAR SLWEWLRRFRGSSSVVPCATPELRQGQDLKSLRVEDFRNCTGPASPHQIKSHTLSTSDRA ARKEHHPSHGASRDKGHPHGHLPGSRSGSKKPGKNCTSHRNRNQISKGSAGKELPELQDY APDYQHKFSFDIMPTARPKRKGKCARRTPIRAPSGVQQAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD50 (ICAM-3) (101-1D2), CF568 conjugate, 0.1mg/mL
BNC680177-100 1x 100 µL

CD50 (ICAM-3) (101-1D2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF640R conjugate, 0.1mg/mL
BNC400257-100 1x 100 µL

Cytokeratin, HMW (AE-3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF740 conjugate, 0.1mg/mL
BNC740257-100 1x 100 µL

Cytokeratin, HMW (AE-3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNF alpha (J2D10), CF405S conjugate, 0.1mg/mL
BNC040994-500 1x 500 µL

TNF alpha (J2D10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (PAb122), CF640R conjugate, 0.1mg/mL
BNC400338-100 1x 100 µL

P53 (PAb122), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (KIP1/769), CF568 conjugate, 0.1mg/mL
BNC680769-100 1x 100 µL

P27 / KIP1 (KIP1/769), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details