Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protein HflK (hflK)

This Recombinant Protein HflK (hflK) spans the amino acid sequence from region 1-400.

Product Specifications

Product Name Alternative

Protein HflK

UniProt

P40605

Expression Region

1-400

Origin

Vibrio parahaemolyticus

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAWNEPGNNNGNNGRDNDPWGNNNRGGQRPGGRDQGPPDLDEVFNKLSQKLGGKFGKKGG GGSSIGGGGGAIGFGVIAIIAIAVWIFAGFYTIGEAERGVVLRLGKYDRIVDPGLNWRPR FIDEYEAVNVQAIRSLRASGLMLTKDENVVTVAMDVQYRVADPYKYLYRVTNADDSLRQA TDSALRAVIGDSLMDSILTSGRQQIRQSTQETLNQIIDSYDMGLVIVDVNFQSARPPEQV KDAFDDAIAAREDEERFIREAEAYKNEILPKATGRAERLKKEAQGYNERVTNEALGQVAQ FEKLLPEYQAAPGVTRDRLYIDAMEEVYTNTSKVLIDSESSGNLLYLPIDKLAGQEGQTD TKRKSKSSSTYDHIQLESERTQEETSNTQSRSTGTRQGRY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Cytosolic phospholipase A2 beta (PLA2G4B) ELISA Kit
MBS7239321-01 48 Well

Human Cytosolic phospholipase A2 beta (PLA2G4B) ELISA Kit

Sign In for Pricing
View Details
Human Cytosolic phospholipase A2 beta (PLA2G4B) ELISA Kit
MBS7239321-02 96 Well

Human Cytosolic phospholipase A2 beta (PLA2G4B) ELISA Kit

Sign In for Pricing
View Details
Human Cytosolic phospholipase A2 beta (PLA2G4B) ELISA Kit
MBS7239321-03 5x 96 Well

Human Cytosolic phospholipase A2 beta (PLA2G4B) ELISA Kit

Sign In for Pricing
View Details
Human Cytosolic phospholipase A2 beta (PLA2G4B) ELISA Kit
MBS7239321-04 10x 96 Well

Human Cytosolic phospholipase A2 beta (PLA2G4B) ELISA Kit

Sign In for Pricing
View Details
Erythropoietin (EPO, EP, Erythropoietin, MGC138142, MVCD2)
MBS6507457-01 0.25 mg

Erythropoietin (EPO, EP, Erythropoietin, MGC138142, MVCD2)

Sign In for Pricing
View Details
Erythropoietin (EPO, EP, Erythropoietin, MGC138142, MVCD2)
MBS6507457-02 5x 0.25 mg

Erythropoietin (EPO, EP, Erythropoietin, MGC138142, MVCD2)

Sign In for Pricing
View Details