Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhizobium meliloti Nodulation protein E (nodE)

This Recombinant Rhizobium meliloti Nodulation protein E (nodE) spans the amino acid sequence from region 1-401.

Product Specifications

Product Name Alternative

Nodulation protein E, Host-specificity of nodulation protein B, EC= 2.3.1.-

UniProt

P06231

Expression Region

1-401

Origin

Rhizobium meliloti (Ensifer meliloti) (Sinorhizobium meliloti)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDRRVVITGMGGLCGLGTDTTSIWKWSARRRSAIGPVLNTELHGLKGIVGAEIKALPDHN IDRKQLVSMDRISVLAVIAAHEAMRQAGLSCNEGNALRFGATVGVGLGGWDATEKAYRPS LSTGGRTEIFTGVKAMPSAAACQVSMSLGLRGPVFGVTSACSSANHAIASAVDQIKCGRA DVMLAGGSDAPLVWIVLKAWEAMRALAPDTCRPFSAGRKGVVLGEGAGMAVLESYEHATA RGATILAEVAGVGLSADAFHITAPAVHGPESAMRACLADAGLNAEDVDYLNAHGTGTKAN DQNETTAIKRVFGDHAYSMSISSTKSTHAHCIGAASALEMIACVMAIQEGVVPPTANYRE PDPDCDLDVTPNVPRERKVRVAMSNAFAMGGTNAVLAFKQV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IL-35 Recombinant Protein C-Fc Tag Lyophilized
MBS8432469-01 0.05 mg

Human IL-35 Recombinant Protein C-Fc Tag Lyophilized

Sign In for Pricing
View Details
Human IL-35 Recombinant Protein C-Fc Tag Lyophilized
MBS8432469-02 5x 0.05 mg

Human IL-35 Recombinant Protein C-Fc Tag Lyophilized

Sign In for Pricing
View Details
DGAT2 siRNA (Rat)
orb1830237-01 15 nmol

DGAT2 siRNA (Rat)

Sign In for Pricing
View Details
DGAT2 siRNA (Rat)
orb1830237-02 30 nmol

DGAT2 siRNA (Rat)

Sign In for Pricing
View Details
Anti-CCR8 Monoclonal Antibody
MBS1752280-01 0.03 mL

Anti-CCR8 Monoclonal Antibody

Sign In for Pricing
View Details
Anti-CCR8 Monoclonal Antibody
MBS1752280-02 0.1 mL

Anti-CCR8 Monoclonal Antibody

Sign In for Pricing
View Details