Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vanderwaltozyma polyspora Nuclear rim protein 1 (NUR1)

This Recombinant Vanderwaltozyma polyspora Nuclear rim protein 1 (NUR1) spans the amino acid sequence from region 1-401.

Product Specifications

Product Name Alternative

Nuclear rim protein 1

UniProt

A7TH24

Expression Region

1-401

Origin

Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) (Kluyveromyces polysporus)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNGLDDENQIDERDHYTDDGDYEIDIDSMNMFKSLYYEMMAYFSDLQMHLGEHLMAIDWD MKCKSIAEPVGNCLTALFYIIRLLQDTLLSNYKDVYVSTEAFDLSKSTTLQEFPFLIRFV EVSKTKNLQNAKYIKKKTFMFYFDKLLLFLMILILSTNAYISWTFIWRNFKTYSLLYVVD RPNSKNVTKCSRTDLDQSYMENVSYGSYWTMLSYYIRNFRKKDDLEDEITTVKQKTPNVN EKDYYYQLKKWSPSKFLTSLFCSFSPTCLVFLILSDVSFTTSIAVILHQFIFKYVVFEGY ESRINDESIIHSAMISEINQKFVEPRLSKKVQDAKIDATPEGKVYRTEFFPSLTNCKSNL FNRHDLKGRSITESYNDRIKEFEIVTNTNNETHNVIKVVKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD71 (66IG10), CF647 conjugate, 0.1mg/mL
BNC470871-500 1x 500 µL

CD71 (66IG10), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF640R conjugate, 0.1mg/mL
BNC400176-100 1x 100 µL

CD5 (Cris-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF740 conjugate, 0.1mg/mL
BNC740149-100 1x 100 µL

CD106 / VCAM1 (1.4C3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cyclin E (G1/S-Phase Cyclin) (CCNE1/2460), CF640R conjugate, 0.1mg/mL
BNC402460-500 1x 500 µL

Cyclin E (G1/S-Phase Cyclin) (CCNE1/2460), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Kappa Light Chain (Kap-56), CF594 conjugate, 0.1mg/mL
BNC940859-100 1x 100 µL

Human Kappa Light Chain (Kap-56), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GP2 (Glycoprotein 2) / ZAP75 (GP2/1805), CF594 conjugate, 0.1mg/mL
BNC941805-500 1x 500 µL

GP2 (Glycoprotein 2) / ZAP75 (GP2/1805), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details