Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas putida Type 4 fimbrial assembly protein PilC (pilC)

This Recombinant Pseudomonas putida Type 4 fimbrial assembly protein PilC (pilC) spans the amino acid sequence from region 1-401.

Product Specifications

Product Name Alternative

Type 4 fimbrial assembly protein PilC

UniProt

P36641

Expression Region

1-401

Origin

Pseudomonas putida (Arthrobacter siderocapsulatus)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPSIRLYAWQGTNADGLAVSGQMAGRSPAYVRAGLLRQGILVARLRPAGRAWRWPKRRE KTDPAGFSRQLATLLKAGVPLLQAFEVMGRSGCDAAQAALLARLKQDVASGLGLADALQR HPGWFDTLYCNLVRVGEQSGTLDRQLEQLAGMLEQRLALHKKLRKAMIYPLLLLLTGLGV SAVLLLEVIPQFQSLFAGFDAALPAFTQWVIDLSTGLGRHAPVLLVSAVLLAVAARELYR KHRPARLWITQRVLGLPVFGKLLGQAALARFARSLATSYAAGVPLLDALGTVAKASGGEL HQQAIQRLRQGMANGQGLNQAMAAEPLFPPLLVQLVAIGESSGTLDQMLEKAASHYEEQV SQALDQLTSLLEPAIVLVLGLLVGGLVVAMYLPIFQLGSLI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 17 (E3), CF488A conjugate, 0.1mg/mL
BNC880158-100 1x 100 µL

Cytokeratin 17 (E3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF568 conjugate, 0.1mg/mL
BNC681429-100 1x 100 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF568 conjugate, 0.1mg/mL
BNC680189-500 1x 500 µL

CD74 (BU45), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF568 conjugate, 0.1mg/mL
BNC680871-500 1x 500 µL

CD71 (66IG10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF647 conjugate, 0.1mg/mL
BNC470151-100 1x 100 µL

CD11a (Cris-3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF640R conjugate, 0.1mg/mL
BNC400861-100 1x 100 µL

HSP27 (G3.1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details