Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhizobium meliloti Nodulation protein E (nodE)

This Recombinant Rhizobium meliloti Nodulation protein E (nodE) spans the amino acid sequence from region 1-402.

Product Specifications

Product Name Alternative

Nodulation protein E, Host-specificity of nodulation protein B, EC= 2.3.1.-

UniProt

P06230

Expression Region

1-402

Origin

Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDRRVVITGMGGLCGLGTDTTSIWKWMREGRSAIGPLLNTELHGLKGIVGAEVKALPDHN IDRKQLVSMDRISVLAVIAAHEAMRQAGLSCNEGNALRFGATVGVGLGGWDATEKAYRTL LVDGGTRTEIFTGVKAMPSAAACQVSMSLGLRGPVFGVTSACSSANHAIASAVDQIKCGR ADVMLAGGSDAPLVWIVLKAWEAMRALAPDTCRPFSAGRKGVVLGEGAGMAVLESYEHAT ARGATILAEVAGVGLSADAFHITAPAVHGPESAMRACLADAGLNAEDVDYLNAHGTGTKA NDQNETTAIKRVFGDHAYSMSISSTKSTHAHCIGAASALEMIACVMAIQEGVVPPTANYR EPDPDCDLDVTPNVPRERKVRVAMSNAFAMGGTNAVLAFKQV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD20 (B9E9), CF740 conjugate, 0.1mg/mL
BNC740160-500 1x 500 µL

CD20 (B9E9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF680 conjugate, 0.1mg/mL
BNC800146-100 1x 100 µL

CD10 (CB-CALLA), CF680 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF568 conjugate, 0.1mg/mL
BNC680175-500 1x 500 µL

CD46 (122.2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF568 conjugate, 0.1mg/mL
BNC680324-500 1x 500 µL

CD53 (161-2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF647 conjugate, 0.1mg/mL
BNC470304-500 1x 500 µL

CD106 / VCAM1 (B-K9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (K8.8 + DC10), CF740 conjugate, 0.1mg/mL