Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhizobium meliloti Nodulation protein E (nodE)

This Recombinant Rhizobium meliloti Nodulation protein E (nodE) spans the amino acid sequence from region 1-402.

Product Specifications

Product Name Alternative

Nodulation protein E, Host-specificity of nodulation protein B, EC= 2.3.1.-

UniProt

P06230

Expression Region

1-402

Origin

Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDRRVVITGMGGLCGLGTDTTSIWKWMREGRSAIGPLLNTELHGLKGIVGAEVKALPDHN IDRKQLVSMDRISVLAVIAAHEAMRQAGLSCNEGNALRFGATVGVGLGGWDATEKAYRTL LVDGGTRTEIFTGVKAMPSAAACQVSMSLGLRGPVFGVTSACSSANHAIASAVDQIKCGR ADVMLAGGSDAPLVWIVLKAWEAMRALAPDTCRPFSAGRKGVVLGEGAGMAVLESYEHAT ARGATILAEVAGVGLSADAFHITAPAVHGPESAMRACLADAGLNAEDVDYLNAHGTGTKA NDQNETTAIKRVFGDHAYSMSISSTKSTHAHCIGAASALEMIACVMAIQEGVVPPTANYR EPDPDCDLDVTPNVPRERKVRVAMSNAFAMGGTNAVLAFKQV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-cAbl Antibody, Affinity Purified
MBS3902128-01 0.01 mg

Rabbit anti-cAbl Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-cAbl Antibody, Affinity Purified
MBS3902128-02 0.1 mg

Rabbit anti-cAbl Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-cAbl Antibody, Affinity Purified
MBS3902128-03 5x 0.01 mg

Rabbit anti-cAbl Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-cAbl Antibody, Affinity Purified
MBS3902128-04 5x 0.1 mg

Rabbit anti-cAbl Antibody, Affinity Purified

Sign In for Pricing
View Details
BLVRB 3'UTR GFP Stable Cell Line
TU051802 1.0 mL

BLVRB 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Anti-BRAF35 Antibody
MBS8203514-01 0.03 mL

Anti-BRAF35 Antibody

Sign In for Pricing
View Details