Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhizobium sp. Nodulation protein E (nodE)

This Recombinant Rhizobium sp. Nodulation protein E (nodE) spans the amino acid sequence from region 1-402.

Product Specifications

Product Name Alternative

Nodulation protein E, Host-specificity of nodulation protein B, EC= 2.3.1.-

UniProt

P72331

Expression Region

1-402

Origin

Rhizobium sp. (strain N33)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDRRVVITGIGGLCGLGTDAPSIWKEMREGRSAIGPIVTSELHGLTGTIGAEIKTLPEHD IDRKQLVTMDRFSLLAVLAAREAMRQAGLSCDERNAYRFGAIVGVGGSGWEAIEASYRAL LLNGARRAGVMDVPKAMPSAAAGQVSMSLGLRGPVFGVTSACASANHAIASAVDQIRCGR ADVMLAGGSDAPFVFCVVKAWEAMRVIAPDTCRPFSSDRRGLVLGEGAGMAVLESYEHAT ARGATIIAEIAGIGLSADAFNLVSPAVEGPEAAMRACLADAGLNVQDVDYINAHGTGTKA NDRMETEAIKRVFGGHANSMSISSTKSMHAHCLGAASALEMIACVMAIQEGVVPPTANYR EPDPDCDLDVTPNVARERKVRVALSNAFAMAGMNAVLAFRQV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hamster Apolipoprotein B ELISA Kit
MBS031436-01 48 Well

Hamster Apolipoprotein B ELISA Kit

Sign In for Pricing
View Details
Hamster Apolipoprotein B ELISA Kit
MBS031436-02 96 Well

Hamster Apolipoprotein B ELISA Kit

Sign In for Pricing
View Details
Hamster Apolipoprotein B ELISA Kit
MBS031436-03 5x 96 Well

Hamster Apolipoprotein B ELISA Kit

Sign In for Pricing
View Details
Hamster Apolipoprotein B ELISA Kit
MBS031436-04 10x 96 Well

Hamster Apolipoprotein B ELISA Kit

Sign In for Pricing
View Details
C-raf 1 (Raf, Raf-1) (MaxLight 490) discontinued
C0039-01-ML490 100 µL

C-raf 1 (Raf, Raf-1) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Human Leucine-twenty homeobox (LEUTX) ELISA Kit
abx530910 96 Tests

Human Leucine-twenty homeobox (LEUTX) ELISA Kit

Sign In for Pricing
View Details