Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhizobium sp. Nodulation protein E (nodE)

This Recombinant Rhizobium sp. Nodulation protein E (nodE) spans the amino acid sequence from region 1-402.

Product Specifications

Product Name Alternative

Nodulation protein E, Host-specificity of nodulation protein B, EC= 2.3.1.-

UniProt

P72331

Expression Region

1-402

Origin

Rhizobium sp. (strain N33)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDRRVVITGIGGLCGLGTDAPSIWKEMREGRSAIGPIVTSELHGLTGTIGAEIKTLPEHD IDRKQLVTMDRFSLLAVLAAREAMRQAGLSCDERNAYRFGAIVGVGGSGWEAIEASYRAL LLNGARRAGVMDVPKAMPSAAAGQVSMSLGLRGPVFGVTSACASANHAIASAVDQIRCGR ADVMLAGGSDAPFVFCVVKAWEAMRVIAPDTCRPFSSDRRGLVLGEGAGMAVLESYEHAT ARGATIIAEIAGIGLSADAFNLVSPAVEGPEAAMRACLADAGLNVQDVDYINAHGTGTKA NDRMETEAIKRVFGGHANSMSISSTKSMHAHCLGAASALEMIACVMAIQEGVVPPTANYR EPDPDCDLDVTPNVARERKVRVALSNAFAMAGMNAVLAFRQV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Ileum
CR561311 5 µg

Tissue Total RNA, Ileum

Sign In for Pricing
View Details
FMNL1 Protein Lysate (Mouse) with C-HA Tag
20687034 100 µg

FMNL1 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
ACAN Protein Vector (Human) (pPM-C-HA)
11145021 500 ng

ACAN Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Cavy Hemicentin-1 (HMCN1) ELISA Kit
MBS9928022 Inquire

Cavy Hemicentin-1 (HMCN1) ELISA Kit

Sign In for Pricing
View Details
GALK2 Rabbit pAb (APR23742N)
APR23742N-01 50 µL

GALK2 Rabbit pAb (APR23742N)

Sign In for Pricing
View Details
GALK2 Rabbit pAb (APR23742N)
APR23742N-02 100 µL

GALK2 Rabbit pAb (APR23742N)

Sign In for Pricing
View Details