Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Equine herpesvirus 1 Envelope glycoprotein I (GI)

This Recombinant Equine herpesvirus 1 Envelope glycoprotein I (GI) spans the amino acid sequence from region 23-424.

Product Specifications

Product Name Alternative

Envelope glycoprotein I, gI

UniProt

P68326

Expression Region

23-424

Origin

Equine herpesvirus 1 (strain AB1) (EHV-1) (Equine abortion virus)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

IIYRGEHMSMYLNASSEFAVYPTDQSLVLVGHLLFLDGQRLPTTNYSGLIELIHYNYSSV CYTVIQTISYESCPRVANNAFRSCLHKTSKHYHDYFRVNASVETNVLLNITKPQPTDSGA YILRVKLDHAPTADVFGVSAFVYDLKSKTVPDPMPTTQTVEPTTSYVSTPTYDYTDDVTT ETESTSTSTQQAMTSTQTPSATWGTQLTTELPTNETVVIGQEALLCHWFQPSTRVPTLYL HLLGRTGNLPEDVLLVEDSEFLRTTSPAHRPSASPADGDDFKQTNSTSLKARNKIVAMVV IPTACVLMLLLVVVGAIINGAVRKHLLSCASRRIYRSGQGGASAAERRRLTCGPTLAASS ESLADDTTSSPPTPKPSKKTKLETDPLMEQLNRKLEAIKEES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD106 / VCAM1 (B-K9), CF488A conjugate, 0.1mg/mL
BNC880304-500 1x 500 µL

CD106 / VCAM1 (B-K9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF740 conjugate, 0.1mg/mL
BNC740204-100 1x 100 µL

Complement C4d (C4D204), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF640R conjugate, 0.1mg/mL
BNC400322-100 1x 100 µL

CD3e (RIV9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BCL2-like 2 (CPTC-BCL2L2-2), CF568 conjugate, 0.1mg/mL
BNC682265-500 1x 500 µL

BCL2-like 2 (CPTC-BCL2L2-2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF640R conjugate, 0.1mg/mL
BNC400324-100 1x 100 µL

CD53 (161-2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rMOC-31), CF568 conjugate, 0.1mg/mL
BNC681819-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rMOC-31), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details