Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ESX-1 secretion-associated protein EspE (espE)

This Recombinant ESX-1 secretion-associated protein EspE (espE) spans the amino acid sequence from region 1-402.

Product Specifications

Product Name Alternative

ESX-1 secretion-associated protein EspE

UniProt

P96213

Expression Region

1-402

Origin

Mycobacterium tuberculosis

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASGSGLCKTTSNFIWGQLLLLGEGIPDPGDIFNTGSSLFKQISDKMGLAIPGTNWIGQA AEAYLNQNIAQQLRAQVMGDLDKLTGNMISNQAKYVSDTRDVLRAMKKMIDGVYKVCKGL EKIPLLGHLWSWELAIPMSGIAMAVVGGALLYLTIMTLMNATNLRGILGRLIEMLTTLPK FPGLPGLPSLPDIIDGLWPPKLPDIPIPGLPDIPGLPDFKWPPTPGSPLFPDLPSFPGFP GFPEFPAIPGFPALPGLPSIPNLFPGLPGLGDLLPGVGDLGKLPTWTELAALPDFLGGFA GLPSLGFGNLLSFASLPTVGQVTATMGQLQQLVAAGGGPSQLASMGSQQAQLISSQAQQG GQQHATLVSDKKEDEEGVAEAERAPIDAGTAASQRGQEGTVL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD56 / NCAM (123C3.D5), CF640R conjugate, 0.1mg/mL
BNC400015-100 1x 100 µL

CD56 / NCAM (123C3.D5), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 / HCAM Std. (Cancer Stem Cell Marker) (rHCAM/918), CF640R conjugate, 0.1mg/mL
BNC403438-500 1x 500 µL

CD44 / HCAM Std. (Cancer Stem Cell Marker) (rHCAM/918), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CAT Rabbit Polyclonal Antibody
TA397037 100 µg

CAT Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Acetaldehyde 2,4-Dinitrophenylhydrazone
TRC-A132700-10MG 10 mg

Acetaldehyde 2,4-Dinitrophenylhydrazone

Sign In for Pricing
View Details
Elab Fluor® 647 Rat IgG2a, λ Isotype Control[B39-4]
E-AB-F09742M-01 20 Tests

Elab Fluor® 647 Rat IgG2a, λ Isotype Control[B39-4]

Sign In for Pricing
View Details
Elab Fluor® 647 Rat IgG2a, λ Isotype Control[B39-4]
E-AB-F09742M-02 100 Tests

Elab Fluor® 647 Rat IgG2a, λ Isotype Control[B39-4]

Sign In for Pricing
View Details