Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nodulation protein E (nodE)

This Recombinant Nodulation protein E (nodE) spans the amino acid sequence from region 1-403.

Product Specifications

Product Name Alternative

Nodulation protein E, Host-specificity of nodulation protein B, EC= 2.3.1.-

UniProt

P04683

Expression Region

1-403

Origin

Rhizobium leguminosarum bv. viciae

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDRRVVITGLGGLCGLGTDASSIWTEMREGRSAIGPISNSEIHELKGMIGTEIKVLPQHD IDRKQLISMDRFSLLAVLAAKQAMLQAGLSCNEGNAHRFGATVGVGFGGWDATEKAYRTL LLGGATRTELFTGVKAMPSAAACQVSMNLGLRGPVFGATSACASANHAIASAVDQIKLGR ADVMLAGGSDAPLVWIVLKAWEAMRVLAPDTCRPFSADRKGLVLGEGAGMAVLESYEHAA ARGATMLAEVAGIGLSADAYHIAAPAVHGPEAAMRACLVDASLNAEDVDYLNAHGTGTKA NDQIETTAIKRVFGDHARSMSISSTKSTHAHCLGAASALEMIACVMAIQEGVVPPTANYR EPDPDCDLDVTPNVPRERKVRVAMSNAFAMGGMNAVLAFKQVP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ICAM3 (NM_002162) Human Recombinant Protein
TP308919M 100 µg

ICAM3 (NM_002162) Human Recombinant Protein

Sign In for Pricing
View Details
Astn2 Mouse Gene Knockout Kit (CRISPR)
KN501702 1 Kit

Astn2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DDX4 (NM_001136034) Human Over-expression Lysate
LY427781 100 µg

DDX4 (NM_001136034) Human Over-expression Lysate

Sign In for Pricing
View Details
NCAM1 / CD56 Recombinant Rabbit monoclonal Antibody
HA751105 100 µL

NCAM1 / CD56 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
L1CAM Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2H4]
TA501453BM 100 µL

L1CAM Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2H4]

Sign In for Pricing
View Details
Recombinant Human CD75/ST6GAL1 Protein (His Tag)
PDEH100707-01 20 µg

Recombinant Human CD75/ST6GAL1 Protein (His Tag)

Sign In for Pricing
View Details