Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Transmembrane protein 246 (Tmem246)

This Recombinant Rat Transmembrane protein 246 (Tmem246) spans the amino acid sequence from region 1-403.

Product Specifications

Product Name Alternative

Transmembrane protein 246

UniProt

Q5EB73

Expression Region

1-403

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTSTSPAAMLLRRLRRLSWGSTAVQLFILTVVTFGLLAPLACHRLLHSYFYLRHWHLNQ MSQDFLQQSLKEGEAALHYFEELPSANGSVPIVWQATPRPWLVITIITVDRQPGFHYVLQ VVSQFHRLLQQCGPQCEGHQLFLCNVERSVSHFDAKLLSKYVPVANRYEGTEDDYGDDPS TNSFEKEKQDYVYCLESSLQTYNPDYVLMVEDDAIPEEQIFPVLEHLLRARFSEPHLQDA LYLKLYHPERLQHYINPEPMRILEWVGVGMLLGPVLTWIYMRFACRPGFSWPVMLFFCLY SMGLVELVGRHYFLELRRLSPSLYSVVPASQCCTPAMLFPAPAARRTLTYLSQVYCHKGF GKDMALYSLLRAKGERAYVVEPNLVKHIGLFSSLRYNFHPSLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P4HA3 Antibody
OACA05208-100UG 100 µg

P4HA3 Antibody

Sign In for Pricing
View Details
OOCA01029-25T - Human LIF Primer Pair 1
OOCA01029-25T 25 Tests

OOCA01029-25T - Human LIF Primer Pair 1

Sign In for Pricing
View Details
CCDC73 siRNA (Mouse)
CRN1751-01 15 nmol

CCDC73 siRNA (Mouse)

Sign In for Pricing
View Details
CCDC73 siRNA (Mouse)
CRN1751-02 30 nmol

CCDC73 siRNA (Mouse)

Sign In for Pricing
View Details
FKBP1A Recombinant Antibody, AbBy Fluor™ 405 Conjugated
bsm-61448R-BF405-01 20 µL

FKBP1A Recombinant Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
FKBP1A Recombinant Antibody, AbBy Fluor™ 405 Conjugated
bsm-61448R-BF405-02 100 µL

FKBP1A Recombinant Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details