Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Transmembrane protein 246 (Tmem246)

This Recombinant Rat Transmembrane protein 246 (Tmem246) spans the amino acid sequence from region 1-403.

Product Specifications

Product Name Alternative

Transmembrane protein 246

UniProt

Q5EB73

Expression Region

1-403

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTSTSPAAMLLRRLRRLSWGSTAVQLFILTVVTFGLLAPLACHRLLHSYFYLRHWHLNQ MSQDFLQQSLKEGEAALHYFEELPSANGSVPIVWQATPRPWLVITIITVDRQPGFHYVLQ VVSQFHRLLQQCGPQCEGHQLFLCNVERSVSHFDAKLLSKYVPVANRYEGTEDDYGDDPS TNSFEKEKQDYVYCLESSLQTYNPDYVLMVEDDAIPEEQIFPVLEHLLRARFSEPHLQDA LYLKLYHPERLQHYINPEPMRILEWVGVGMLLGPVLTWIYMRFACRPGFSWPVMLFFCLY SMGLVELVGRHYFLELRRLSPSLYSVVPASQCCTPAMLFPAPAARRTLTYLSQVYCHKGF GKDMALYSLLRAKGERAYVVEPNLVKHIGLFSSLRYNFHPSLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vangl2 (NM_001105969) Rat Tagged ORF Clone Lentiviral Particle
RR207730L4V 200 µL

Vangl2 (NM_001105969) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Olr1598 (NM_001000910) Rat Tagged ORF Clone Lentiviral Particle
RR210702L3V 200 µL

Olr1598 (NM_001000910) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Mast Cell Chymase (CMA1)
MBS618805-01 0.1 mg

Mast Cell Chymase (CMA1)

Sign In for Pricing
View Details
Mast Cell Chymase (CMA1)
MBS618805-02 5x 0.1 mg

Mast Cell Chymase (CMA1)

Sign In for Pricing
View Details
C15orf55 Protein Vector (Human) (pPB-His-GST)
PV329039 500 ng

C15orf55 Protein Vector (Human) (pPB-His-GST)

Sign In for Pricing
View Details
Human HEY2 Knockout A549 cell line
GTR15402444 1 Vial

Human HEY2 Knockout A549 cell line

Sign In for Pricing
View Details