Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Tripartite motif-containing protein 59 (Trim59)

This Recombinant Mouse Tripartite motif-containing protein 59 (Trim59) spans the amino acid sequence from region 1-403.

Product Specifications

Product Name Alternative

Tripartite motif-containing protein 59, RING finger protein 1

UniProt

Q922Y2

Expression Region

1-403

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHNFEEELTCPICYSIFEDPRVLPCSHTFCRNCLENVLQASGNFYIWRPLRIPLKCPNCR SIIEIASTGIESLPVNFALRAIIEKYQQEDHPDVVTCPEHYRQPLNVYCLLDKKLVCGHC LTIGQHHGHPIDDLQSAYLKEKDTPQKLLKQLTDTHWTDITRLIEKLEEQKCHSEKIVQG DKEVVLQYFKELIDTLEQKKKYFLAALCDVGKMINQEYTPQIQGMKEIREQQLELMTITT SLQDESPLKFLEKIDEVRQRVQMLKQRPLPEVQPVEIYPRVSNVLKEEWSRIEIGRIKKA VIPEMRVSSKRTPCSWSDNDEKEMELFKILNIAIVSLISVILMLILLFNHHIITFLNEIT SICFSEVFLSVYQSLSKNLYDLNNTVCYTLYLLKEFMWKIVSR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD28 (204.12), CF740 conjugate, 0.1mg/mL
BNC740164-500 1x 500 µL

CD28 (204.12), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF488A conjugate, 0.1mg/mL
BNC880257-500 1x 500 µL

Cytokeratin, HMW (AE-3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pmel17 / gp100 / SILV (NKI-beteb), CF640R conjugate, 0.1mg/mL
BNC400226-500 1x 500 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 / HCAM Std. (HCAM/2875R), CF640R conjugate, 0.1mg/mL
BNC402875-500 1x 500 µL

CD44 / HCAM Std. (HCAM/2875R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Progesterone Receptor (PR501), CF740 conjugate, 0.1mg/mL
BNC740501-500 1x 500 µL

Progesterone Receptor (PR501), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ksp-Cadherin (Kidney-Specific Cadherin) / CDH16 (CDH16/1532R), CF740 conjugate, 0.1mg/mL
BNC741532-100 1x 100 µL

Ksp-Cadherin (Kidney-Specific Cadherin) / CDH16 (CDH16/1532R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details