Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 246 (Tmem246)

This Recombinant Mouse Transmembrane protein 246 (Tmem246) spans the amino acid sequence from region 1-403.

Product Specifications

Product Name Alternative

Transmembrane protein 246

UniProt

Q91YV9

Expression Region

1-403

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTSTSPAAMLLRRLRRLSWGSTAVQLFILTVVTFGLLAPLACHRLLHSYFYLRHWHLNQ MSQDFLQQSLKEGEAALHYFEELPSANGSVPIVWQATPRPWLVITIITVDRQPGFHYVLQ VVSQFHRLLQQCGPQCEGHQLFLCNVERSVSHFDAKLLSKYVPVANRYEGTEDDYGDDPS TNSFEKEKQDYVYCLESSLQTYNPDYVLMVEDDAIPEEQIFPVLEHLLRARFSEPHLQDA LYLKLYHPERLQHYINPEPMRILEWVGVGMLLGPVLTWIYMRFACRPGFSWPVMLFFCLY SMGLVELVGRHYFLELRRLSPSLYSVVPASQCCTPAMLFPAPAARRTLTYLSQVYCHKGF GKDMALYSLLRAKGERAYVVEPNLVKHIGLFSSLRYNFHPSLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Benzyl 2,3-anhydro-β-D-ribopyranoside
GC7844-100mg 100 mg

Benzyl 2,3-anhydro-β-D-ribopyranoside

Sign In for Pricing
View Details
Recombinant Mycoplasma Pneumoniae MPN_147 Protein (aa 1-485)
VAng-Lsx04843-1mgEcoli 1 mg (E. coli)

Recombinant Mycoplasma Pneumoniae MPN_147 Protein (aa 1-485)

Sign In for Pricing
View Details
Phospho-c-Jun (Tyr170) Polyclonal Antibody, Cy7 Conjugated
bs-5463R-Cy7 100 µL

Phospho-c-Jun (Tyr170) Polyclonal Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
RPS2P21 AAV siRNA Pooled Vector
42453161 1.0 µg

RPS2P21 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Lgr4 Rat shRNA Plasmid (Locus ID 286994)
TR713403 1 Kit

Lgr4 Rat shRNA Plasmid (Locus ID 286994)

Sign In for Pricing
View Details
Arid1a Mouse Gene Knockout Kit (CRISPR)
KN501547 1 Kit

Arid1a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details