Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 246 (Tmem246)

This Recombinant Mouse Transmembrane protein 246 (Tmem246) spans the amino acid sequence from region 1-403.

Product Specifications

Product Name Alternative

Transmembrane protein 246

UniProt

Q91YV9

Expression Region

1-403

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTSTSPAAMLLRRLRRLSWGSTAVQLFILTVVTFGLLAPLACHRLLHSYFYLRHWHLNQ MSQDFLQQSLKEGEAALHYFEELPSANGSVPIVWQATPRPWLVITIITVDRQPGFHYVLQ VVSQFHRLLQQCGPQCEGHQLFLCNVERSVSHFDAKLLSKYVPVANRYEGTEDDYGDDPS TNSFEKEKQDYVYCLESSLQTYNPDYVLMVEDDAIPEEQIFPVLEHLLRARFSEPHLQDA LYLKLYHPERLQHYINPEPMRILEWVGVGMLLGPVLTWIYMRFACRPGFSWPVMLFFCLY SMGLVELVGRHYFLELRRLSPSLYSVVPASQCCTPAMLFPAPAARRTLTYLSQVYCHKGF GKDMALYSLLRAKGERAYVVEPNLVKHIGLFSSLRYNFHPSLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CMV-Luciferase (Renilla), (GFP-Bsd), Concentrated Lentivirus
LVP368-PBS 1x 10^8 IFU/mL - 200 μL

CMV-Luciferase (Renilla), (GFP-Bsd), Concentrated Lentivirus

Sign In for Pricing
View Details
Xlr3b Mouse shRNA Plasmid (Locus ID 574437)
TR518183 1 Kit

Xlr3b Mouse shRNA Plasmid (Locus ID 574437)

Sign In for Pricing
View Details
Conical erlen. 250ml S 3435 Qfit
QFE25050 5 / PCK

Conical erlen. 250ml S 3435 Qfit

Sign In for Pricing
View Details
SLC6A15 antibody - N-terminal region
MBS3207141-01 0.1 mL

SLC6A15 antibody - N-terminal region

Sign In for Pricing
View Details
SLC6A15 antibody - N-terminal region
MBS3207141-02 5x 0.1 mL

SLC6A15 antibody - N-terminal region

Sign In for Pricing
View Details
Tfam Peptide - middle region
MBS3238961-01 0.1 mg

Tfam Peptide - middle region

Sign In for Pricing
View Details