Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 246 (Tmem246)

This Recombinant Mouse Transmembrane protein 246 (Tmem246) spans the amino acid sequence from region 1-403.

Product Specifications

Product Name Alternative

Transmembrane protein 246

UniProt

Q91YV9

Expression Region

1-403

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTSTSPAAMLLRRLRRLSWGSTAVQLFILTVVTFGLLAPLACHRLLHSYFYLRHWHLNQ MSQDFLQQSLKEGEAALHYFEELPSANGSVPIVWQATPRPWLVITIITVDRQPGFHYVLQ VVSQFHRLLQQCGPQCEGHQLFLCNVERSVSHFDAKLLSKYVPVANRYEGTEDDYGDDPS TNSFEKEKQDYVYCLESSLQTYNPDYVLMVEDDAIPEEQIFPVLEHLLRARFSEPHLQDA LYLKLYHPERLQHYINPEPMRILEWVGVGMLLGPVLTWIYMRFACRPGFSWPVMLFFCLY SMGLVELVGRHYFLELRRLSPSLYSVVPASQCCTPAMLFPAPAARRTLTYLSQVYCHKGF GKDMALYSLLRAKGERAYVVEPNLVKHIGLFSSLRYNFHPSLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Cplane1 shRNA (UAS) - Lentiviral mouse Cplane1 shRNA (UAS, iRFP) (25)
GTR15265358 1 Vial

Lentiviral mouse Cplane1 shRNA (UAS) - Lentiviral mouse Cplane1 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Human EEA1 (Early Endosome Antigen 1) ELISA Kit
MBS8803379-01 48 Well

Human EEA1 (Early Endosome Antigen 1) ELISA Kit

Sign In for Pricing
View Details
Human EEA1 (Early Endosome Antigen 1) ELISA Kit
MBS8803379-02 96 Well

Human EEA1 (Early Endosome Antigen 1) ELISA Kit

Sign In for Pricing
View Details
Human EEA1 (Early Endosome Antigen 1) ELISA Kit
MBS8803379-03 5x 96 Well

Human EEA1 (Early Endosome Antigen 1) ELISA Kit

Sign In for Pricing
View Details
Human EEA1 (Early Endosome Antigen 1) ELISA Kit
MBS8803379-04 10x 96 Well

Human EEA1 (Early Endosome Antigen 1) ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal ABHD1 Antibody [Alexa Fluor 532]
NBP2-99171AF532 0.1 mL

Rabbit Polyclonal ABHD1 Antibody [Alexa Fluor 532]

Sign In for Pricing
View Details