Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Type II secretion system protein F (outF)

This Recombinant Type II secretion system protein F (outF) spans the amino acid sequence from region 1-404.

Product Specifications

Product Name Alternative

Type II secretion system protein F, T2SS protein F, General secretion pathway protein F, Pectic enzymes secretion protein OutF

UniProt

P31704

Expression Region

1-404

Origin

Erwinia chrysanthemi

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MALFQYQALNAQGKKSQGMQEADSARHARQLLREKGLVPVKIEEQRGEAAPRSGFSLSFG RSHRIASDLALLTRQLATLVAALPLEEALDAVAKQSEKPKLSALMAAVRAKVVEGHSLAE AMGNFPGSFERLYCAMVAAGEASGHLDAVLNRLADYTEQRHEMRSRIQQAMIYPCVLTLV AISVVSILLSAVVPKVVEQFIHMKQALPLSTRLLMSASDAVRTYGPWVVLLLVLAIMGFR VLLRQEKHRLVFHRRLLFLPVVGRVARGLNTARYARTLSILNSSAVPLLQAMRISGDVLT NDYARFRLGQATDAVREGVTLHKALEQTALFPPMMRHMIASERRRARRHVNPRGDNQDRE FSAQMTLVLGLFEPLLVVSMAGIVLFIVLAILQPILQLNTLMSM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SYNE3 Antibody (C-term)
MBS9210495-01 0.08 mL

SYNE3 Antibody (C-term)

Sign In for Pricing
View Details
SYNE3 Antibody (C-term)
MBS9210495-02 0.4 mL

SYNE3 Antibody (C-term)

Sign In for Pricing
View Details
SYNE3 Antibody (C-term)
MBS9210495-03 5x 0.4 mL

SYNE3 Antibody (C-term)

Sign In for Pricing
View Details
MTMR12 (NM_001040446) Human Tagged ORF Clone Lentiviral Particle
RC214077L3V 200 µL

MTMR12 (NM_001040446) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
TRPA1 Antagonist 3
HY-139904 1 Each

TRPA1 Antagonist 3

Sign In for Pricing
View Details
Lmo3 Mouse shRNA Lentiviral Particle (Locus ID 109593)
TL505898V 500 µL Each

Lmo3 Mouse shRNA Lentiviral Particle (Locus ID 109593)

Sign In for Pricing
View Details