Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Type II secretion system protein F (outF)

This Recombinant Type II secretion system protein F (outF) spans the amino acid sequence from region 1-404.

Product Specifications

Product Name Alternative

Type II secretion system protein F, T2SS protein F, General secretion pathway protein F, Pectic enzymes secretion protein OutF

UniProt

P31704

Expression Region

1-404

Origin

Erwinia chrysanthemi

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MALFQYQALNAQGKKSQGMQEADSARHARQLLREKGLVPVKIEEQRGEAAPRSGFSLSFG RSHRIASDLALLTRQLATLVAALPLEEALDAVAKQSEKPKLSALMAAVRAKVVEGHSLAE AMGNFPGSFERLYCAMVAAGEASGHLDAVLNRLADYTEQRHEMRSRIQQAMIYPCVLTLV AISVVSILLSAVVPKVVEQFIHMKQALPLSTRLLMSASDAVRTYGPWVVLLLVLAIMGFR VLLRQEKHRLVFHRRLLFLPVVGRVARGLNTARYARTLSILNSSAVPLLQAMRISGDVLT NDYARFRLGQATDAVREGVTLHKALEQTALFPPMMRHMIASERRRARRHVNPRGDNQDRE FSAQMTLVLGLFEPLLVVSMAGIVLFIVLAILQPILQLNTLMSM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant human BASP1 protein
ATGP1956-100 100 µg

Recombinant human BASP1 protein

Sign In for Pricing
View Details
Equine IL-10 Affinity Purified Polyclonal Ab
AF1605 100 µg

Equine IL-10 Affinity Purified Polyclonal Ab

Sign In for Pricing
View Details
NOTCH1 siRNA (Rat)
CRR0721-01 15 nmol

NOTCH1 siRNA (Rat)

Sign In for Pricing
View Details
NOTCH1 siRNA (Rat)
CRR0721-02 30 nmol

NOTCH1 siRNA (Rat)

Sign In for Pricing
View Details
Trichohyalin (TCHH) Antibody
abx128351-01 100 µL

Trichohyalin (TCHH) Antibody

Sign In for Pricing
View Details
Trichohyalin (TCHH) Antibody
abx128351-02 200 µL

Trichohyalin (TCHH) Antibody

Sign In for Pricing
View Details