Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterobacteria phage M13 Virion export protein (IV)

This Recombinant Enterobacteria phage M13 Virion export protein (IV) spans the amino acid sequence from region 22-426.

Product Specifications

Product Name Alternative

Virion export protein, Gene 4 protein, G4P

UniProt

P03665

Expression Region

22-426

Origin

Enterobacteria phage M13 (Bacteriophage M13)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

QVIEMNNSPLRDFVTWYSKQSGESVIVSPDVKGTVTVYSSDVKPENLRNFFISVLRANNF DMVGSIPSIIQKYNPNNQDYIDELPSSDNQEYDDNSAPSGGFFVPQNDNVTQTFKINNVR AKDLIRVVELFVKSNTSKSSNVLSIDGSNLLVVSAPKDILDNLPQFLSTVDLPTDQILIE GLIFEVQQGDALDFSFAAGSQRGTVAGGVNTDRLTSVLSSAGGSFGIFNGDVLGLSVRAL KTNSHSKILSVPRILTLSGQKGSISVGQNVPFITGRVTGESANVNNPFQTIERQNVGISM SVFPVAMAGGNIVLDITSKADSLSSSTQASDVITNQRSIATTVNLRDGQTLLLGGLTDYK NTSQDSGVPFLSKIPLIGLLFSSRSDSNEESTLYVLVKATIVRAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tex47 Mouse Gene Knockout Kit (CRISPR)
KN500342 1 Kit

Tex47 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TIM 3 (HAVCR2) Mouse Monoclonal Antibody [Clone ID: OTI2E5]
CF812559 100 µg

TIM 3 (HAVCR2) Mouse Monoclonal Antibody [Clone ID: OTI2E5]

Sign In for Pricing
View Details
Hsp90-alpha Antibody
KC-254-01 50 μL

Hsp90-alpha Antibody

Sign In for Pricing
View Details
Hsp90-alpha Antibody
KC-254-02 100 µL

Hsp90-alpha Antibody

Sign In for Pricing
View Details
Hsp90-alpha Antibody
KC-254-03 1 mL

Hsp90-alpha Antibody

Sign In for Pricing
View Details
TBX20 Mouse Monoclonal Antibody [Clone ID: OTI3D12]
CF809355 100 µg

TBX20 Mouse Monoclonal Antibody [Clone ID: OTI3D12]

Sign In for Pricing
View Details