Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterobacteria phage fd Virion export protein (IV)

This Recombinant Enterobacteria phage fd Virion export protein (IV) spans the amino acid sequence from region 22-426.

Product Specifications

Product Name Alternative

Virion export protein, Gene 4 protein, G4P

UniProt

P03664

Expression Region

22-426

Origin

Enterobacteria phage fd (Bacteriophage fd)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

QVIEMNNSPLRDFVTWYSKQTGESVIVSPDVKGTVTVYSSDVKPENLRNFFISVLRANNF DMVGSIPSIIQKYNPNSQDYIDELPSSDIQEYDDNSAPSGGFFVPQNDNVTQTFKINNVR AKDLIRVVELFVKSNTSKSSNVLSVDGSNLLVVSAPKDILDNLPQFLSTVDLPTDQILIE GLIFEVQQGDALDFSFAAGSQRGTVAGGVNTDRLTSVLSSAGGSFGIFNGDVLGLSVRAL KTNSHSKILSVPRILTLSGQKGSISVGQNVPFITGRVTGESANVNNPFQTVERQNVGISM SVFPVAMAGGNIVLDITSKADSLSSSTQASDVITNQRSIATTVNLRDGQTLLLGGLTDYK NTSQDSGVPFLSKIPLIGLLFSSRSDSNEESTLYVLVKATIVRAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vom2r57 Protein Vector (Rat) (pPM-C-HA)
PV315860 500 ng

Vom2r57 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
TMEM255A Antibody, FITC conjugated
A57227-50UG 50 µg

TMEM255A Antibody, FITC conjugated

Sign In for Pricing
View Details
FAM131C Mouse Monoclonal Antibody [Clone 1C1]
E45M19848V-2 50 µL

FAM131C Mouse Monoclonal Antibody [Clone 1C1]

Sign In for Pricing
View Details
Ccdc44 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6621606 1.0 µg DNA

Ccdc44 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Cptp Antibody
orb859348 2 mg

Cptp Antibody

Sign In for Pricing
View Details
Anti-Leptin Receptor Rabbit Monoclonal Antibody
MA3488-.05 50 µL

Anti-Leptin Receptor Rabbit Monoclonal Antibody

Sign In for Pricing
View Details