Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis ABC transporter permease ytrF (ytrF)

This Recombinant Bacillus subtilis ABC transporter permease ytrF (ytrF) spans the amino acid sequence from region 32-436.

Product Specifications

Product Name Alternative

ABC transporter permease ytrF

UniProt

O35005

Expression Region

32-436

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CAFLVVLSSVGFGIQKTITDMTMSQQIVTKVSVMGKEGDKPIKKADLEKYDHVRSVVERT QVYEPNKATLGNRTNESSNLIFTNMNDELKANMELEKGRVAKSENEIVVGYDFAKRLLTK KESEEYNKKIEEAKGNPEDIKEPKGYTKDILNKTIELSVSKTDSKTGDVTKTKTYDFKIV GITKKPSQDWMEDSNIFISDQFKKDFSEFLDFKGGNVETNIGVFADKFENVEQLTNDLTD DGYYVTSVTTELEGANTFFMVFKIGLIFVGCIAVIISAIGIFNTMTMAVTERTQEIGIMK AIGASPSIIRRMFLMESAYIGILGCVIGIIISYGVSYLVNLAVPMILAATSGGDAGDLNY TFSYIPASLVIIAVVICGGVAVISGMNPARKATKTNVLTALRREL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IgA Secretory Component (SC05), CF568 conjugate, 0.1mg/mL
BNC680050-500 1x 500 µL

IgA Secretory Component (SC05), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF568 conjugate, 0.1mg/mL
BNC680009-500 1x 500 µL

MART-1 / Melan-A (M2-7C10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF594 conjugate, 0.1mg/mL
BNC940158-500 1x 500 µL

Cytokeratin 17 (E3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF740 conjugate, 0.1mg/mL
BNC740160-500 1x 500 µL

CD20 (B9E9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Caldesmon, HMW (h-Caldesmon) (h-CALD), CF640R conjugate, 0.1mg/mL
BNC400819-100 1x 100 µL

Caldesmon, HMW (h-Caldesmon) (h-CALD), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX4 (Master Regulator of Epithelial-Mesenchymal Transition) (SOX4/2540), CF647 conjugate, 0.1mg/mL
BNC472540-100 1x 100 µL

SOX4 (Master Regulator of Epithelial-Mesenchymal Transition) (SOX4/2540), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details